Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha (Fcer1a), partial

In Stock
Code CSB-MP008532MO1
Abbreviation Recombinant Mouse Fcer1a protein, partial
MSDS
Size $102
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Fc-epsilon RI-alpha;IgE Fc receptor subunit alpha
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
24-204aa
Target Protein Sequence
ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
49.9 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Gene References into Functions
  1. House Dust Mite-Induced Allergic Airway Disease Is Independent of IgE and FcepsilonRIalpha. PMID: 28700253
  2. this study shows that mast cells co-cultured with macrophages alter protein expression of both cell types, and that mast cells transfer FceRI-encompassed cellular regions directly to macrophages during Francisella tularensis PMID: 27554051
  3. Tim-3 acts at a receptor-proximal point to enhance Lyn kinase-dependent signaling pathways that modulate both immediate-phase degranulation and late-phase cytokine production downstream of FcepsilonRI ligation. PMID: 26598760
  4. Conferring expression of FcepsilonRI to dendritic cells decreases the severity of food allergy and asthma in disease-relevant models suggesting anti-inflammatory IgE/FcepsilonRI signals. PMID: 25227985
  5. IgE-mediated activation of dendritic cells via IgE receptors binding in allergic Th2-type inflammation appears to be immune regulatory rather than pro-inflammatory. (Review) PMID: 26052071
  6. Specific cross-linking of the high affinity immunoglobulin epsilon receptor on the surface of bone marrow-derived mast cells and heart mast cells elicits the release of enzymatically active renin protein. PMID: 24262755
  7. Zinc-binding MT1 and MT2 are key modulators of Fc epsilonRI-induced basophil production of IL-4. PMID: 25801306
  8. Loss of Tespa1 in mouse mast cells led to hyper-responsiveness to stimulation via FcepsilonRI. PMID: 25422497
  9. IgE-mediated allergic hypersensitivity provokes release of renin from both cultured and resident cardiac mast cells. PMID: 24262755
  10. Overexpression of miR-142-3p enhances FcepsilonRI-mediated degranulation. PMID: 24361879
  11. OX40L engagement impairs FcepsilonRI activation and Gab2/PI3K/Akt, but not Syk/LAT, phosphorylation PMID: 22564682
  12. FcepsilonRI, but not FcgammaR, signals induce prostaglandin D2 and E2 production from basophils PMID: 21712025
  13. data implicate Fyn as the major positive mediator of STAT5 after FcepsilonRI engagement and demonstrate importantly distinct roles for STAT5A and STAT5B in mast cell function. PMID: 22130676
  14. Reduced IgE/antigen-mediated passive cutaneous anaphylaxis is detected in mice with Piga-deficient mast cells. PMID: 21865342
  15. The PI3K binding site is involved in FcepsilonRI-dependent ARF1 activation and granule translocation to the plasma membrane in the degranulation process, further dissecting the signals required for degranulation. PMID: 21653832
  16. Whereas FcepsilonRI required Lyn and Syk for NTAL phosphorylation, Kit appeared to directly phosphorylate NTAL. PMID: 17993265
  17. This is the first observation to attribute a spatiotemporally restricted antigen-presenting function to a subset of three-week old pure BMMC expressing both high levels of surface FcepsilonRI and surface major histocompatibility complex II. PMID: 20591187
  18. Peripheral blood basophils express approximately 50% of the Fc epsilon RI density of bone marrow (BM) basophils. A 3-fold greater synthetic rate of Fc epsilon RI on BM basophils readily explains the difference. PMID: 20042574
  19. Fc epsilon RI-mediated calcium flux (dependent on PLC gamma 1) leads to degranulation of mast cells independent of PI 3-kinase PMID: 13129935
  20. FcepsilonRI stimulation triggers the formation of microtubules in a manner independent of calcium. Drugs affecting microtubule dynamics effectively suppressed the FcepsilonRI-mediated translocation of granules to the plasma membrane and degranulation. PMID: 15998803
  21. SHIP and Src homology 2 domain-containing protein tyrosine phosphatase-1 interacted with FcepsilonRI beta, and their phosphorylation was controlled by Lyn. PMID: 16272347
  22. Fc receptor gamma RI interacts with the unrelated immunoreceptors FcalphaRI and FcepsilonRI PMID: 16627486
  23. The length of the stalk region of the alpha-chain is an important determinant of Fc epsilon receptor IA stability on the cell surface. PMID: 16709862
  24. IL-33 prolonged mast cell survival in the absence of IgE and impaired survival in the presence of SPE-7 IgE. PMID: 17881510
  25. These findings show that the extracellular domain of the type I transmembrane protein Fc epsilon RI alpha plays a role in Fc epsilon RI intracellular processing and expression at the cell surface. PMID: 18179824
  26. the high affinity of IgE for FcepsilonRI is critical to the allergic response, and that even moderate attenuation of this affinity has a substantial effect in vivo PMID: 18703499
  27. positive and negative regulators of FcepsilonRI have roles in mast cell activation [review] PMID: 19082920
  28. autoantibodies against Fcer1a is present in 30-50% urticaria patients PMID: 19331714
  29. Fc(epsilon)RIand CD16 thus contribute to atopic dermatitis but differentially regulate immune responses associated with the disease. PMID: 19414806
  30. the role of PI3Kgamma on the Fc epsilon RI mediated mast cell migration. PMID: 19494508
  31. Data suggest that PTPepsilon negatively regulates FcepsilonRI-mediated signalling pathways and thus constitutes a novel target for ameliorating allergic conditions. PMID: 19508371

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed in bone marrow mast cells, as well as in the pineal gland at night.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*