Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Mcl1Induced myeloid leukemia cell differentiation protein Mcl-1 homolog; Bcl-2-related protein EAT/mcl1
Species
Mus musculus (Mouse)
Expression Region
1-308aa
Target Protein Sequence
MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGG
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3
working days after receiving your orders. Delivery time may differ from different purchasing way or
location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with
normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance
and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The Mouse Mcl1 recombinant protein is conventionally generated by transfecting the recombinant DNA into a host cell, and then the host cells are cultured and the transfected DNA transcribed and translated. Different host cells can be chosen for recombinant protein production, the choice of which depends on the type of protein that needs to be generated, its functional activity and requisite yield. We choose E.coli as the expression system for this Mcl1 protein expression because bacteria cells are easy to culture, grow fast and produce high yields of recombinant protein.
MCL1 is a protein coding gene that encodes Induced myeloid leukemia cell differentiation protein Mcl-1 homolog. According to some studies, MCL1 may have the following features.
MCL1 is a gene expressed in programmed myeloid cell differentiation and shares sequence similarity with BCL2. The deubiquitinase USP9X stabilizes MCL1 and promotes tumor cell survival. Sensitivity to antineoplastic chemotherapeutics is regulated by MCL1 and FBW7. The MCL1 inhibitor S63845 was tolerable and potent in different cancer models. MCL1 provides a window into the role of the BCL2 family in cell proliferation, differentiation and tumorigenesis. MCL1 is an important regulator of GC-induced apoptosis. SCF FBW7 regulates apoptosis by targeting MCL1 for ubiquitination and destruction.