Recombinant Mouse Prominin-1 (Prom1),Partial

In Stock Promotion
Code CSB-EP018751MO
Abbreviation Recombinant Mouse Prom1 protein, partial
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
others
Alternative Names
Prom1; Prom; Proml1; Prominin-1; Antigen AC133 homolog; Prominin-like protein 1; CD antigen CD133
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
509-794aa
Target Protein Sequence
GANVEKLLCEPYENKKLLQVLDTPYLLKEQWQFYLSGMLFNNPDINMTFEQVYRDCKRGRGIYAAFQLENVVNVSDHFNIDQISENINTELENLNVNIDSIELLDNTGRKSLEDFAHSGIDTIDYSTYLKETEKSPTEVNLLTFASTLEAKANQLPEGKPKQAFLLDVQNIRAIHQHLLPPVQQSLNTLRQSVWTLQQTSNKLPEKVKKILASLDSVQHFLTNNVSLIVIGETKKFGKTILGYFEHYLHWVFYAITEKMTSCKPMATAMDSAVNGILCGYVADPLN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.5kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6XHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play a role in cell differentiation, proliferation and apoptosis. Binds cholesterol in cholesterol-containing plasma membrane microdomains and may play a role in the organization of the apical plasma membrane in epithelial cells. During early retinal development acts as a key regulator of disk morphogenesis. Involved in regulation of MAPK and Akt signaling pathways. In neuroblastoma cells suppresses cell differentiation such as neurite outgrowth in a RET-dependent manner.
Gene References into Functions
  1. Hypomyelination in CD133(-/-) mice was associated with fewer oligodendrocyte progenitor cells and mature oligodendrocytes. Behavioral analyses revealed that significantly impaired object recognition memory and altered Y-maze performance by CD133(-/-) mice compared with wild-type mice, suggesting perturbed cognitive performance. PMID: 29772232
  2. Study evaluated the different components of the mouse subventricular zone (SVZ) during the first week after chemical induction of type 1 and type 2 diabetes-like (T1DM and T2DM) conditions. Only T2DM mice showed SVZ damage. The initial lesions were localized to ependymal cilia, which appeared disorientated and clumped together. In addition, they showed delocalization of the ciliary membrane protein prominin-1. PMID: 28743634
  3. CD133-CD55- common progenitors are the main source of CXCL12 and Kitl producing cells in the developing marrow. PMID: 27929130
  4. During biliary fibrosis Prominin-1-expressing progenitor cells transdifferentiate into cells within ductular reactions. This transdifferentiation may promote fibrosis. PMID: 28104292
  5. findings clearly demonstrate that Wnt ligands produced by CD133+ DP cells play an important role in postnatal hair growth by maintaining the inductivity of DP cells and mediating the signaling cross-talk between the mesenchyme and the epithelial compartment PMID: 27462123
  6. Prom1 positive pulmonary vascular endothelial cells can play a role in local pulmonary vascular homeostasis and repair. PMID: 27059286
  7. High CD133 promoted stem-ness characteristics and metastasis potential in sphere-forming liver cancer stem cells. PMID: 26735577
  8. Prom1+ dermal papilla(DP) cells do not contribute to dermal repair but are nevertheless capable of regulating DP size via beta-catenin-mediated intercellular communication. PMID: 26288357
  9. These findings support PROM1 as a tumor cell-intrinsic marker related to glioblastoma survival, independent of its stem cell properties, and highlight potentially divergent roles for this protein in normal mouse and human glia. PMID: 25184684
  10. The Prom1-knockout retina showed strong downregulation of expression of the visual cycle components, Rdh12 and Abca4 PMID: 25414197
  11. Expansion of collagen-producing PROM1 positive cells within regions of periportal fibrosis is associated with activated fibroblast growth factor (FGF) and (TGF)beta pathways in biliary atresia. PMID: 24798639
  12. CD133 is upregulated during neurogenesis. PMID: 23723983
  13. CD133, a stem cell marker in mice: results in animal models cannot always be applied to human skin. PMID: 23495873
  14. role of CD133 in growth of proneural glioma PMID: 23637986
  15. In vivo tumor growth in NOD/SCID mouse xenografts of liver cancer stem cells were significantly repressed after CD133 silencing. PMID: 23233126
  16. CD133 modifies frequencies of growth-factor responsive hematopoietic progenitor cells during steady state and after myelotoxic stress in vivo. PMID: 23509298
  17. a net decrease in hippocampal neurogenesis, by 30% was found in Prominin-1 knock-out mice PMID: 23407958
  18. Evidence for self-renewal capacity was obtained by serial transplantation of long-term epidermal repopulating units derived from CD133(+) and CD133(+)DeltaPsim(hi) keratinocytes. PMID: 22763787
  19. CD133-positive glioma stem-like cells isolated from murine transplanted gliomas exhibit higher invasive potential after being cocultured with tumor-associated microglia/macrophages. PMID: 22664874
  20. The microenvironment of the inflamed fibrotic lung impairs the regenerative capacity of bone marrow-derived prominin-1+ progenitor cells and promotes their differentiation into pathogenic phenotypes. PMID: 21943210
  21. MiR-34a targeting of Notch ligand delta-like 1 impairs CD15+/CD133+ tumor-propagating cells and supports neural differentiation in medulloblastoma PMID: 21931765
  22. increased CD133 expression occurs at early stages of colon tumorigenesis in the mouse PMID: 22199291
  23. Sox17 might be a key transcription factor controlling CD133 expression, and that it might also play a role in the control of gastric tumor progression. PMID: 21457403
  24. Data reveal a novel, functional role for Prom1 that is not related to stem cell activity, and demonstrate the importance of tissue-specific characterization of putative stem cell markers. PMID: 21337465
  25. CD133 positivity defines a genetically distinct cellular compartment in primary colorectal cancer cells PMID: 21435437
  26. analysis of CD133/prominin in human and mouse cells PMID: 21187924
  27. In addition to conserved expression of prominin-1 in photoreceptors, significant prominin-1-expressing non-photoreceptor retinal cell populations are present in the vertebrate eye. PMID: 21407811
  28. Mouse prominin-1 is widely expressed in prostate whereas in human only some luminal cells express it PMID: 20717901
  29. CD133, CD15/SSEA-1, and CD34 do not resume tumor-initiating properties of long-term cultured malignant glio-neuronal stem cells PMID: 20181261
  30. CD133 may have a role in chemo-resistant Ewing sarcoma cells PMID: 20346143
  31. the majority of mouse prominin-1 splice variants are widely expressed in mouse tissues PMID: 20808829
  32. This study showed that resident microvascular CD133+ pericytes with presumptive stem cell potential are sensitive to spinal cord injury. PMID: 20374199
  33. Our data show that CD133 expression is not selective for sphere forming, tumor-initiating or radioresistant subpopulations in the HCT-116 CRC cell lines. PMID: 19699546
  34. prominin-1 is involved in the formation and/or stabilization of epididymal stereocilia and the tail of spermatozoa, and hence might play a dual role in the biogenesis of spermatozoa. PMID: 15316084
  35. prominin-1/CD133 is expressed in embryonic stem cell-derived progenitors PMID: 15917475
  36. colorectal cancer is created and propagated by a small number of undifferentiated tumorigenic CD133+ cells, which should therefore be the target of future therapies PMID: 17122771
  37. We propose that the prominin-1/CD133 is a novel surface marker useful for collecting dermal papilla (DP) cells in the anagen stage and for analyzing the function of DP. PMID: 17185982
  38. Apical midbodies of neuroepithelial cells concentrate prominin-1 (CD133), a somatic stem cell marker and defining constituent of a specific plasma membrane microdomain. PMID: 17283184
  39. These data suggest that CD133-positive brown adipose tissue-derived cells are a useful tool as cardiomyocytes (CM) inducers, as well as a source of CMs. PMID: 17289932
  40. expression of the marker Prominin-1 and in the three pairs of major salivary glands, i.e., submandibular-, major sublingual-, and parotid glands in mice PMID: 17874118
  41. CD133(+) ependymal cells represent an additional-perhaps more quiescent-stem cell population in the mammalian forebrain PMID: 18195354
  42. CD133 has roles in metastatic colon cancer and is expressed in colon cancer stem cells PMID: 18497883
  43. CD133 expression is not restricted to intestinal stem or cancer-initiating cells, and during the metastatic transition, CD133+ tumor cells might give rise to the more aggressive CD133(- )subset, which is also capable of tumor initiation in NOD/SCID mice PMID: 18497886
  44. Prominin-1+/CD133+ bone marrow-derived heart-resident cells suppress experimental autoimmune myocarditis. PMID: 18621802
  45. CD133(+)CD44(+) population had the ability to produce colon tumor. PMID: 18663533
  46. This study suggest that complex expression pattern of prominin-1 molecules in developing adult brain. Given that prominin-1 is thought to act as an organizer of plasma membrane protrusions. PMID: 19053060
  47. data indicate that Prom1 marks stem cells in the adult small intestine that are susceptible to transformation into tumours retaining a fraction of mutant Prom1(+) tumour cells PMID: 19092805
  48. CD133(+)CD45(-) oval cells isolated from premalignant 16-month-old Mat1a(-/-) mice demonstrated significant resistance to transforming growth factor-beta-induced apoptosis compared to CD133(-) cells. PMID: 19115422
  49. Loss of Prom-1 results in progressive degeneration of mature photoreceptors with complete loss of vision. PMID: 19228982
  50. Data suggest the possibility that CD133 may be specifically down-regulated during G0/G1, and this should be considered when this marker is used to identify and isolate other tissue and cancer stem cells. PMID: 19430532

Show More

Hide All

Subcellular Location
Apical cell membrane; Multi-pass membrane protein. Cell projection, microvillus membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment. Endoplasmic reticulum. Endoplasmic reticulum-Golgi intermediate compartment. Note=Found in extracellular membrane particles in various body fluids such as ventricular fluid of the developing brain and urine.
Protein Families
Prominin family
Tissue Specificity
In the submandibular gland, expressed on the apical side of epithelial cells. In the parotid gland, expressed in the intercalated ducts. In the sublingual gland, expressed in intercalated ducts. In the extraorbital lacrimal gland, expressed in the interca
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*