Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-YP004458PI |
| Product Type | Recombinant Protein |
| Size | US$2959 |
| Uniprot No. | P28491 |
| Lead Time | 3-7 business days |
| Relevance | Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export (By similarity). Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | Alternative name(s):CRP55;Calregulin;Endoplasmic reticulum resident protein 60 Short name:ERp60 HACBP |
| Species | Sus scrofa (Pig) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | EPTIYFKEQFLDGDGWTDRWIESKHKPDFGRFVLSSGKFYGDQEKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPDGLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAVKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDSNIYAYENFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEEKKRKEEEEVDKEDEEDKDEDEEEEDEKEEEEEEDAAAGQAKDEL |
| Research Area | Tags & Cell Markers |
| Source | Yeast |
| Gene Names | CALR |
| Protein Names | Recommended name: Calreticulin Alternative name(s): CRP55 Calregulin Endoplasmic reticulum resident protein 60 Short name= ERp60 HACBP |
| Expression Region | 18-417aa |
| Tag Info | N-terminal 6xHis-tagged |
| Mol. Weight | 48.6kDa |
| Protein Description | Full Length of Mature Protein |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export (By similarity). Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis. |
| Subcellular Location | Endoplasmic reticulum lumen, Sarcoplasmic reticulum lumen, Cytoplasm, perinuclear region, Membrane |
| Protein Families | Calreticulin family |
| Tissue Specificity | In blastocyst expressed in all blastomeres (at protein level). In embryos, expressed in spleen, kidney, liver, fat, muscle, ovary, granulosa cells and cumulus cells. |
| Database Links |
KEGG: ssc:100381266 STRING: 9823.ENSSSCP00000014615 UniGene: Ssc.48945 |
| Pathway |
Protein processing in endoplasmic reticulum
Antigen processing and presentation |
CALR Antibodies for Sus scrofa (Pig)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA004458YA01PI | CALR Antibody | Pig | ELISA |
| CSB-PA004458YB01PI | CALR Antibody, HRP conjugated | Pig | ELISA |
| CSB-PA004458YC01PI | CALR Antibody, FITC conjugated | Pig | ELISA |
| CSB-PA004458YD01PI | CALR Antibody, Biotin conjugated | Pig | ELISA |
CALR Proteins for Sus scrofa (Pig)
| Code | Product Name | Source |
|---|---|---|
| CSB-EP004458PI CSB-BP004458PI CSB-MP004458PI |
Recombinant Pig Calreticulin(CALR) | E.coli Baculovirus Mammalian cell |
Recombinant Human Proteasome activator complex subunit 1(PSME1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Interleukin-2 receptor subunit beta(Il2rb),partial
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Nuclear receptor subfamily 4 group A member 2(NR4A2)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Melanoma-associated antigen 10(MAGEA10)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Rabbit Tropomyosin alpha-1 chain(TPM1)
Express system: Yeast
Species: Oryctolagus cuniculus (Rabbit)
Recombinant Human E3 ubiquitin-protein ligase RBX1(RBX1)
Express system: E.coli
Species: Homo sapiens (Human)
