Recombinant Pig Vascular endothelial growth factor A (VEGFA)

In Stock
Code CSB-EP025833PI
Abbreviation Recombinant Pig VEGFA protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
VEGFA; VEGFVascular endothelial growth factor A; VEGF-A; Vascular permeability factor; VPF
Species
Sus scrofa (Pig)
Source
E.coli
Expression Region
27-190aa
Target Protein Sequence
APMAEGDQKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development.
Gene References into Functions
  1. It regulates endometrial remodeling in the porcine endometrial tissues during follicular and luteal phase. PMID: 28139071
  2. It was concluded that VEGF and factor VIII are important growth factors associated with fetal development in pigs and are identified in all uterine segments. PMID: 28237345
  3. results are consistent with a participation of (VEFG) in the regulation of the dynamics of oviductal fluid secretion and the oviduct contractibility PMID: 28257866
  4. Here we demonstrate that VEGF-165 mediates MSC differentiation into ECs via VEGFR-2-dependent induction of Sox18, which ultimately coordinates the transcriptional upregulation of specific markers of the EC phenotype. PMID: 25913202
  5. VEGF was significantly downregulated 7 days after cryotherapy of the sclera and stayed at that level until day 14. It returned to baseline by day 21. PMID: 25510786
  6. VEGF production, blood vessel network and follicle remodeling are impaired by the antiprogesterone RU486. PMID: 24756033
  7. findings suggest that the augmented neovascular response seen with VEGF administration was through the VEGF-induced upregulation of Notch signaling. PMID: 24366099
  8. interleukin-1beta-induced vascular endothelial growth factor in airway smooth muscle cells PMID: 24142467
  9. Upregulation of VEGF during hypoxia in chondrocyte is mediated partially through HIF-1alpha. PMID: 22970342
  10. data shows that members of the VEGF-VEGFR system are temporally and spatially well localized for playing key roles during umbilical cord formation and its intensive growth observed after day 75 of pregnancy PMID: 20825582
  11. cardiac-specific and hypoxia-induced coexpression of VEGF and Ang1 improves the perfusion and function of porcine MI heart through the induction of angiogenesis and cardiomyocyte proliferation PMID: 21245320
  12. The mRNA for VEGFA was expressed in early developing and in maturing glomeruli. PMID: 20713984
  13. Data show that subventricular zone neural stem cells express VEGF and all VEGF splice variants, VEGFR1, VEGFR2 and Neuropilin-1 and -2 mRNAs. PMID: 20552272
  14. The earlier increase in VEGF protein and mRNA expression in the Meishan versus the Yorkshire conceptus may explain the previously reported increased vascularity and increased placental efficiency of this breed compared the Yorkshire breed. PMID: 14998908
  15. Contrast media did not affect bone marrow cell viability/VEGF secretion. PMID: 15274157
  16. VEGF upregulation in the proliferative zone after ischemic damage may play a role in stimulating vascular invasion and granulation tissue formation in the necrotic hypertrophic zone of the epiphyseal cartilage PMID: 15537448
  17. Data demonstrate that lipopolysaccharides evoke a heat shock response, with an increase heat shock proteins 70 and Hsp32) and of VEGF, a specific endothelial cell growth factor. PMID: 16333987
  18. Vascular endothelial growth factor (VEGF) plays an important role in the thecal angiogenesis during follicular development. PMID: 16372043
  19. number of preovulatory follicles and the capillary density in the theca interna increased significantly in the ovaries injected with VEGF gene PMID: 16538032
  20. our study revealed the presence of VEGF in endothelial and smooth muscle cells of vascular subovarian plexus arteries PMID: 16584087
  21. Differential regulation of VEGF isoforms may suggest specific physiological roles for some of them, particularly in angioregression occurring during the apoptotic structural luteolysis. PMID: 16967516
  22. VEGF ligand-receptor system may play an important role in the development and maintenance of the corpus luteum in pigs. PMID: 17120307
  23. Sanguinarine inhibited both VEGF production and VEGF-induced Akt activation in swine granulosa cells. PMID: 17310078
  24. VEGF/Flk-1/Flt-1 system is activated during myocardial ischemia reperfusion injury. PMID: 17868880
  25. VEGF-A family members are probably involved in appropriate preparation of endometrium for implantation and in vascular events during implantation in pigs. PMID: 17874446
  26. Hemodialysis graft placement leads to early increases in wall shear stress, VEGF-A, pro-MMP-9, MMP-2, VEGFR-1, VEGFR-2, and TIMP-1, which may contribute to the development of venous stenosis. PMID: 18326810
  27. Interaction of soluble factors in plasma possibly generated during PICSO are not responsible for upregulation of HO-1 and VEGF mRNA. PMID: 19618599

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
PDGF/VEGF growth factor family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*