Recombinant Rat Interleukin-18 (Il18)

Code CSB-RP176194r
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Il18
Uniprot No.
Research Area
Others
Alternative Names
Il18; Igif; Interleukin-18; IL-18; Interferon gamma-inducing factor; IFN-gamma-inducing factor; Interleukin-1 gamma; IL-1 gamma
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
37-194aa
Target Protein Sequence
HFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
22.3kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
A proinflammatory cytokine primarily involved in polarized T-helper 1 (Th1) cell and natural killer (NK) cell immune responses. Upon binding to IL18R1 and IL18RAP, forms a signaling ternary complex which activates NF-kappa-B, triggering synthesis of inflammatory mediators. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells and natural killer (NK) cells.
Gene References into Functions
  1. IL18 and the related markers were closely associated with the occurrence and development of deep venous thrombosis. PMID: 29786104
  2. These observations suggest that IL-18 exerts direct effects upon the GnRH neuron via IL-18Ralpha and acts on GnRH neurons through an autocrine or paracrine pathway. PMID: 28373090
  3. These findings also indicate that IL-18 is an important regulator leading to MMP-13 expression and cell migration in astrocytes. PMID: 26558633
  4. These results suggest that the expression of interferon-gamma via IL-18 in the lenses of OVX rats is induced by ovariectomy PMID: 26725437
  5. Excessive IL-18 Relate the Aggravation of Indomethacin-Induced Intestinal Ulcerogenic Lesions in Adjuvant-Induced Arthritis Rat PMID: 26424019
  6. results provided evidence that delivery of IL-18 and IFN-beta by BMSCs may be an excellent and promising approach to develop an effective treatment protocol for glioma therapy. PMID: 26252165
  7. PMA treatment during a vulnerable period can alter brain development. IL-18 and IRAK-4 appear to be important for the development of PMA induced injury. PMID: 25918710
  8. Remifentanil protects the liver against I/R injury by modulating hepatic IL-18/IL-18BP balance and inhibiting IL-18 signaling PMID: 25919765
  9. The results in vitro showed the protective effect of IL-18 on cortical neurons. PMID: 25022959
  10. Using Dynamic Bayesian Network inference, we identified interleukin-18 as a central node associated with neuropathic pain in chronic sciatic constriction injury in rats. PMID: 26004155
  11. IL-18 can augment the hepatocyte growth ability via NF-kappaB and p38/ATF2 by targeting cyclin B1, cyclin B2, cyclin A2 and Bcl-2 in BRL-3A rat liver cells. PMID: 25752290
  12. IL-18 serves as a positive regulator of hepatocyte proliferation. PMID: 24412291
  13. IL18 was significantly increased in rat benign prostatic hyperplasia tissue. PMID: 24615654
  14. During learning, changes in IL-18 are restricted to the dorsal hippocampus. PMID: 23747799
  15. Changes in macrophage IL-18 and vascular fibrinogen deopsition following injury in aging rats contribute to local inflammation and postinjury neointima formation. PMID: 24414074
  16. interferon-gamma increases NF-kappaB and cytokine IL-18, but decreases IL-27 in acute pancreatitis PMID: 23725508
  17. IFN-gamma production via IL-18 in the retinas of 60-week-old OLETF rats is caused by hyperglycemia, and plays a role in the inflammation of the OLETF rat retinas. PMID: 23823918
  18. Chronic exposure of Sprague-Dawley rats to second hand smoke results in a significant increase of proinflammatory cytokine IL-18 in the bronchoalveolar lavage fluid. PMID: 23392573
  19. IL-18 expression increases in brain following chronic neuroinflammation elicited by systemic inflammation. PMID: 22642744
  20. Il-18-mediated up-regulation plays a role in maintenance of blood brain barrier function following status elepticus. PMID: 22338606
  21. Our findings are the first report that injury of trigeminal nerve induced IL-18 upregulation in activated microglia in the Vc, suggesting a possible role of IL-18 in orofacial neuropathic pain. PMID: 23000553
  22. Serum IL-18 level increased in the process of deep vein thrombosis. PMID: 22318348
  23. Suggest that the angiotensin II/AT1/Nox1/IL-18 pathway is a critical factor in hyperplastic vascular diseases. PMID: 22636674
  24. The treatment of rats with anti-IL-18 antibody at the time of burn injury prevented intestine apoptosis and normalized tight junction proteins following EtOH and burn injury. PMID: 22001439
  25. differential expression in abortive rats as compared to of pregnant and non-pregnant rats PMID: 21920610
  26. These results indicate that IL-18 secreted by microglia, which was activated by C6 glioma-derived ECM, enhanced migration of C6 glioma through NO/cGMP pathway. PMID: 21442623
  27. IL-18 delays neutrophil apoptosis following EtOH and burn injury by modulating the pro- and antiapoptotic proteins. PMID: 20844839
  28. Expression of IL-18, IL-6 and oxidative stress in rat peritoneal mesothelial cells stimulated by lipopolysaccharide PMID: 21882482
  29. The expression of IL-18 was increased in the lenses of OLETF rat. It is possible that activated IL-18 in the lenses of OLETF rat may be related to the lens epithelial cell apotosis and lens opacification. PMID: 21591858
  30. IL-18 may serve as an additional marker to monitor the severity of inflammation during pancreatitis. PMID: 21273803
  31. Transcripts of core components of NOD-like receptor Nlrp6 inflammasome (Nlrp6, Pycard, Caspase-1) and one of its substrates, IL-18, were increased at E20 compared with E16 in fetal intestine and not lung. PMID: 21088234
  32. chronic elevated IL-18 levels at a supraphsiological concentration aggravated insulin resistance, enhanced vascular inflammation and remodeling, probably by increasing the level of IRAK1 and the activity of NF-kappaB PMID: 19717152
  33. Role in acute lung inflammation PMID: 11739527
  34. Up-regulation of IL-18 and IL-12 in the ileum of neonatal rats with necrotizing enterocolitis. PMID: 12032269
  35. IL-18 occured in the medial habenula (MHbS), the interpenducular nucleus, and in the ependymal cells surrounding the third and the lateral ventricles. Restraint stress induced a strong elevation of IL-18 in the MHbS but not in ependymal cells. PMID: 12468024
  36. The frequent expression of IL-18 in thyrocytes suggests that IL-18 itself might be a secreted immunomodulator in autoimmune thyroid disease PMID: 12490070
  37. Translational control of IL-18 expression by its 5'-UTR limits production of IL-18, resulting in restricted expression of mRNA and protein IFN-gamma in this model of crescentic glomerulonephritis(GN). Might amplify CD8+-mediated macrophage-dependent GN. PMID: 12787406
  38. IL-18 induces CXCL16 expression via a MyD88, IRAK1-IRAK4-TRAF6, c-Src, PI3K, Akt, JNK, AP-1 pathway PMID: 15890643
  39. IL-18 may have host-protective and growth-promoting functions in the testis. PMID: 16002206
  40. The combined insult of EtOH and burn injury results in increased CORT levels, which in turn up-regulates intestinal IL-18 levels and thereby causes altered intestinal barrier function following a combined insult of EtOH intoxication and burn injury. PMID: 16707557
  41. These results identify a critical role for IL-18 in neointimal formation in a rat model of vascular injury and suggest a potential role for IL-18 neutralization in the reduction of neointimal development. PMID: 16864728
  42. mRNA and the protein level were attenuated by post hypoxia-ischemia hypothermia and that post hypoxia-ischemia hypothermia may decrease microglia activation in the developing brain. PMID: 17010950
  43. Presence of neutrophils appears to be critical for IL-18-meditaed increased lung tissue edema following a combined insult of ethanol and burn injury. PMID: 17220368
  44. IL-18 plays a role in enhancing the lipopolysaccharide-induced neutrophilic inflammation of the lung, but does not affect the resolution of inflammation. PMID: 17352829
  45. IL-18 is regulated by parathyroid hormone and is required for its bone anabolic actions PMID: 18165223
  46. Augmented IL-18 in serum and cardiac tissue in metabolic syndrome may contribute to the coronary perivascular fibrosis. PMID: 18504504
  47. Rapamycin and Sanglifehrin A, but not Cyclosporin A, block IL-18 production and this novel Rapamycin blockade effect on IL-18 may contribute to the ability of Rapamycin to inhibit chronic allograft nephropathy and restenosis. PMID: 18662782
  48. Our results indicate that IL-18-mediated microglia/astrocyte interactions in the spinal cord have a substantial role in the generation of tactile allodynia. PMID: 19036970
  49. Neutrophil chemokines CINC-1/3 may have a role in IL-18-mediated increase in neutrophil O2- production and intestinal edema following alcohol intoxication and burn injury. PMID: 19497959

Show More

Hide All

Subcellular Location
Cytoplasm. Secreted.
Protein Families
IL-1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*