Recombinant Sheep Interleukin-1 beta(IL1B)

In Stock
Code CSB-EP011614SH
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names IL1B
Uniprot No. P21621
Research Area Others
Alternative Names IL1BInterleukin-1 beta; IL-1 beta
Species Ovis aries (Sheep)
Source E.coli
Expression Region 114-266aa
Target Protein Sequence AAVQSVKCKLQDREQKSLVLDSPCVLKALHLPSQEMSREVVFCMSFVQGEERDNKIPVALGIRDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEEKPVFLGRFRGGQDITDFRMETLSP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 21.7kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production.
Gene References into Functions
  1. Intravenous injection of SB203580 successfully inhibited synthesis of IL-1beta and reduced the production of IL-6 in the hypothalamus. PMID: 24995301
  2. Interleukin-1beta was increased only on the injured side of multifidus in disc disease. PMID: 24718080
  3. Inactivation of RhoA due to lack of prenylation leads to Rac1 activation and subsequent priming for IL-1beta secretion. PMID: 25107911
  4. RANTES-403 was significantly associated with the risk of developing diffuse-type gastric cancer in men and found a possible gene-gene interaction between RANTES and IL-1B polymorphisms in gastric cancer carcinogenesis. PMID: 24323564
  5. In vitro studies with IL-1-beta and TNF-alpha challenges, both proinflammatory cytokines resulted in elevated levels of CCL5 in conditioned media (p<0.01) PMID: 24468005
  6. These results showed that IL-1beta and IL-1 receptor types I and II were expressed in the ovine hypothalamus in response to lipopolysaccharide injection. PMID: 20345592
  7. These data are consistent with the effects of LPS on GH secretion originating through peripheral cytokine presentation to the pituitary, as well as a potential to act directly on selective populations of pituitary cells via CD14. PMID: 15899940
  8. plasma IL-1 beta, TNF-alpha and MCP-1 may potentially serve as markers to monitor prognosis of pregnancy toxaemia in ewes PMID: 17221363

Show More

Hide All

Subcellular Location Cytoplasm, cytosol, Lysosome, Secreted, exosome, Cytoplasmic vesicle, autophagosome, Secreted
Protein Families IL-1 family
Database Links

KEGG: oas:443539

UniGene: Oar.434

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1