Recombinant human Seryl-tRNA synthetase,Cytoplasmic domain protein (SERS), partial

Code CSB-EP020709HU1
Abbreviation Recombinant Human SERS protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
SARS
Uniprot No.
Research Area
Metabolism
Alternative Names
C78314; cytoplasmic; EC 6.1.1.11; FLJ36399; sarS; Sars1; Serine tRNA ligase 1, cytoplasmic; Serine tRNA ligase; Serine--tRNA ligase; serine--tRNA ligase, cytoplasmic; SerRS; SERS; Seryl tRNA Ser/Sec synthetase; Seryl tRNA synthetase; Seryl tRNA synthetase cytoplasmic; Seryl-tRNA Ser/Sec synthetase; Seryl-tRNA synthetase; seryl-tRNA synthetase, cytoplasmic; Seryl-tRNA(Ser/Sec) synthetase; Strs; SYSC_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-233aa
Target Protein Sequence
VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
53.4kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the attachment of serine to tRNA(Ser) in a two-step reaction: serine is first activated by ATP to form Ser-AMP and then transferred to the acceptor end of tRNA(Ser). Is probably also able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec). In the nucleus, binds to the VEGFA core promoter and prevents MYC binding and transcriptional activation by MYC. Recruits SIRT2 to the VEGFA promoter, promoting deacetylation of histone H4 at 'Lys-16' (H4K16). Thereby, inhibits the production of VEGFA and sprouting angiogenesis mediated by VEGFA.
Gene References into Functions
  1. Here, we report on mutations in two aminoacyl-tRNA synthetases that are associated with Intellectual disability (ID) in two unrelated Iranian families. In the first family, we identified a homozygous missense mutation (c.514G>A, p.Asp172Asn) in the cytoplasmic seryl-tRNA synthetase (SARS) gene PMID: 28236339
  2. Analyzed the ability of cytosolic SerRS to bind and act on tRNA(Ser), tRNA(Sec), and 10 mutant and chimeric constructs in which elements of tRNA(Ser) were transposed onto tRNA(Sec). We show that SerRS only subtly prefers tRNA(Ser) to tRNA(Sec), and that discrimination occurs at the level of the serylation reaction. PMID: 28808125
  3. Yin Yang 1 (YY1) interacts with Seryl-tRNA synthetase (SerRS) to form a SerRS/YY1 complex which functions as a negative effector to regulate vegfa transcription through binding a distal segment of the vegfa promoter, while NFKB1 serves as a positive effector through outcompeting SerRS/YY1 for binding at the same distal segment. PMID: 27913726
  4. tRNA recognition mode of SerRS. PMID: 26433229
  5. Several data support that p.R402H mutation in SARS2 is a new cause of HUPRA syndrome. PMID: 24034276
  6. A long-range conformational and functional communication specific to higher eukaryotes is found in human SerRS. PMID: 24095058
  7. study identified a nuclear localization signal sequence embedded in UNE-S domain and showed that the essential role of SerRS in vascular development is dependent on UNE-S and its role to mobilize SerRS from the cytoplasm to the nucleus PMID: 22353712
  8. Mutations in the mitochondrial seryl-tRNA synthetase cause hyperuricemia, pulmonary hypertension, renal failure in infancy and alkalosis, HUPRA syndrome. PMID: 21255763
  9. Recombinant human cytosolic seryl-tRNA synthetase protein was purified to homogeneity and crystallized. Diffraction data were collected to 3.13 A resolution. PMID: 21045311
  10. SARS regulates endothelial sprouting. These analyses of zebrafish and human endothelial cells reveal a new noncanonical function of Sars in endothelial development. PMID: 19423847

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus.
Protein Families
Class-II aminoacyl-tRNA synthetase family, Type-1 seryl-tRNA synthetase subfamily
Tissue Specificity
Brain.
Database Links

HGNC: 10537

OMIM: 607529

KEGG: hsa:6301

STRING: 9606.ENSP00000234677

UniGene: Hs.531176

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*