Recombinant mouse platelet factor 4 (Pf4)

Code CSB-EP017809MO
Abbreviation Recombinant Mouse Pf4 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Pf4; Cxcl4; Scyb4; Platelet factor 4; PF-4; C-X-C motif chemokine 4
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
30-105aa
Target Protein Sequence
VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation.
Gene References into Functions
  1. these data demonstrate that PF4 has an important role in increasing B cell differentiation in the bone marrow environment PMID: 28914425
  2. these results identify CXCL4 as a vital immunoregulatory chemokine essential for protecting mice against influenza A virus infection, especially as it affects the development of lung injury and neutrophil mobilization to the inflamed lung PMID: 28120850
  3. These results indicate that CXCL4 is a novel Ni-binding protein that augments Ni allergy at the elicitation and sensitization phases. This is the first study to demonstrate that the Ni-binding protein augments Ni allergy in vivo. PMID: 28319310
  4. PF4 was produced by Ly6G+CD11b+ immature myeloid cells in the early stage premetastatic lungs, and decreased during metastatic progression. PMID: 27223426
  5. These data demonstrate that the CXCR2 network and CXCL4 play a role in the maintenance of normal HSC/HPC cell fates, including survival and self-renewal. PMID: 27222476
  6. Platelet-derived CXCL7 and CXCL4 contribute to the pathogenesis of acute lung injury. PMID: 27755915
  7. CXCL4 plays an important role in pancreatic inflammation PMID: 27183218
  8. Platelet secretion of CXCL4 is Rac1-dependent and regulates neutrophil infiltration and tissue damage in septic lung damage PMID: 26478565
  9. PF4 has a complex intramedullary life cycle with important implications in megakaryopoiesis and hematopoietic stem cell replication not seen with other tested alpha granule proteins. PMID: 26256688
  10. Heparin enhances antigen uptake and activation of the initial steps in the cellular immune response to PF4-containing complexes. PMID: 25960020
  11. Data indicate that platelet factor 4 (PF4) is involved directly in liver innate immune response against ischaemia-reperfusion injury (IRI) by regulating Th17 cell differentiation. PMID: 25440775
  12. CXCL4 regulates hematopoietic stem cell cell cycle activity. PMID: 25326802
  13. Platelet factor 4 has a role in regulating Th17 differentiation and cardiac allograft rejection PMID: 24463452
  14. Histones regulate activated protein C formation in a manner similar to PF4 and suggest heparinoids may be benificial in sepsis. PMID: 24177324
  15. PF4 drives a vascular smooth muscle inflammatory phenotype including a decline in differentiation markers, increased cytokine production, and cell proliferation. PMID: 23568488
  16. PF4 expression on intestinal epithelial cells is increased after IR at both the mRNA and protein levels. In conclusion, these findings demonstrate that may PF4 represent an important mediator of local and remote tissue damage. PMID: 22792197
  17. These results suggest that Cxcl4 and Cxcl7 play a role in the development of neurobehavioral alterations that are triggered by in utero TCDD exposure and later surface in adults. PMID: 21509788
  18. PF4 may have a role in bacterial defense, and heparin-induced thrombocytopenia is probably a misdirected antibacterial host defense mechanism. PMID: 20959601
  19. In vivo, half-life and diffusibility of CXCL4L1 compared with Cxcl4 is strongly increased. PMID: 20688960
  20. These data indicate that PF4 induction of monocyte KLF4 expression may be an important step in the pathogenesis of experimental cerebral malaria. PMID: 20454664
  21. Micronutrients effectively promote tumor dormancy in early prostate cancer by inducing platelet factor-4 expression and concentrating it at the tumor endothelium through enhanced platelet binding. PMID: 20525356
  22. CXC chemokine ligand 4 (Cxcl4) is a platelet-derived mediator of experimental liver fibrosis. PMID: 20162727
  23. important role for PF4 in thrombosis and neutralization of PF4 is an important component of heparin's anticoagulant effect. PMID: 14764524
  24. Platelet factor 4 and interleukin-8 CXC chemokine heterodimer formation modulates function at the quaternary structural level PMID: 15531763
  25. the PF4 storage pathway in alpha-granules is not a default pathway, but rather a regular granule storage pathway probably requiring specific sorting mechanisms PMID: 15613031
  26. analysis of granule targeting sequence within platelet factor 4 PMID: 15964840
  27. clinical heterogeneity in the HIT immune response may be due in part to requirements for specific biophysical parameters of the PF4/heparin complexes that occur in settings of intense platelet activation and PF4 release PMID: 17848616
  28. platelet-associated PF-4, but not its plasma counterpart, may represent a potential biomarker of early tumor presence PMID: 17914028
  29. platelet specific chemokine PF4 promotes atherosclerotic lesion development in vivo PMID: 18000617
  30. Brain microglia are a cellular source of CXCL4 gene expression. PMID: 18248618
  31. platelet-derived PF4 contributes to immune activation and T cell trafficking as part of the pathogenesis of experimental cerebral malaria . PMID: 18692777
  32. Platelet factor 4 regulates megakaryopoiesis through low-density lipoprotein receptor-related protein 1 (LRP1) on megakaryocytes. PMID: 19605848

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Intercrine alpha (chemokine CxC) family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*