Recombinant Chicken Epidermal growth factor receptor(EGFR)

Code CSB-CF007479CH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P13387
Storage Buffer Tris-based buffer,50% glycerol
Species Gallus gallus (Chicken)
Sequence VEEKKVCQGTNNKLTQLGHVEDHFTSLQRMYNNCEVVLSNLEITYVEHNRDLTFLKTIQE VAGYVLIALNMVDVIPLENLQIIRGNVLYDNSFALAVLSNYHMNKTQGLRELPMKRLSEI LNGGVKISNNPKLCNMDTVLWNDIIDTSRKPLTVLDFASNLSSCPKCHPNCTEDHCWGAG EQNCQTLTKVICAQQCSGRCRGKVPSDCCHNQCAAGCTGPRESDCLACRKFRDDATCKDT CPPLVLYNPTTYQMDVNPEGKYSFGATCVRECPHNYVVTDHGSCVRSCNTDTYEVEENGV RKCKKCDGLCSKVCNGIGIGELKGILSINATNIDSFKNCTKINGDVSILPVAFLGDAFTK TLPLDPKKLDVFRTVKEISGFLLIQAWPDNATDLYAFENLEIIRGRTKQHGQYSLAVVNL KIQSLGLRSLKEISDGDIAIMKNKNLCYADTMNWRSLFATQSQKTKIIQNRNKNDCTADR HVCDPLCSDVGCWGPGPFHCFSCRFFSRQKECVKQCNILQGEPREFERDSKCLPCHSECL VQNSTAYNTTCSGPGPDHCMKCAHFIDGPHCVKACPAGVLGENDTLVWKYADANAVCQLC HPNCTRGCKGPGLEGCPNGSKTPSIAAGVVGGLLCLVVVGLGIGLYLRRRHIVRKRTLRR LLQERELVEPLTP
Source in vitro E.coli expression system
Gene Names EGFR
Protein Names Recommended name: Epidermal growth factor receptor Short name= CER EC= 2.7.10.1
Expression Region 31-703
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor tyrosine kinase binding ligands of the EGF family and activating several signaling cascades to convert extracellular cues into appropriate cellular responses
Subcellular Location Cell membrane, Single-pass type I membrane protein, Endoplasmic reticulum membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Nucleus membrane, Single-pass type I membrane protein, Endosome, Endosome membrane, Nucleus
Protein Families Protein kinase superfamily, Tyr protein kinase family, EGF receptor subfamily
Database Links

KEGG: gga:396494

STRING: 9031.ENSGALP00000020165

UniGene: Gga.35024

Pathway Calcium signaling pathway
ErbB signaling pathway
Estrogen signaling pathway
HIF-1 signaling pathway
Jak-STAT signaling pathway
MAPK signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Adherens junction
Ras signaling pathway
FoxO signaling pathway
Phospholipase D signaling pathway
Rap1 signaling pathway
Endocytosis

Related Products

EGFR Proteins

EGFR Proteins for Gallus gallus (Chicken)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.