Recombinant Human Adenosine receptor A1 (ADORA1)-VLPs

Code CSB-MP001375HU
MSDS
Size
Order now
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
ADORA1
Uniprot No.
Research Area
G-protein coupled receptor, Receptor, Transducer
Alternative Names
ADORA1; Adenosine receptor A1
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-326aa
Target Protein Sequence
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it’s possible to develop.
Form
Lyophilized powder
Note: We will default ship it in lyophilized form with normal bule ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice, please communicate with us in advance and extra fees for dry ice and dry ice box will be charged.
Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for adenosine. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase.
Gene References into Functions
  1. ADORA1 is not a common risk factor or causal gene for Parkinson's disease or dementia with Lewy bodies in the European population PMID: 27987235
  2. monocyte-derived macrophages from ankylosing spondylitis patients expressed increased levels of A2AAR and reduced levels of A1 and A2BAR compared to healthy controls PMID: 29524036
  3. studies revealed individual trait characteristics for being either vulnerable or resilient to both alcohol and to sleep deprivation. Both interventions induce gradual increases in cerebral A1AR availability, pointing to a potential common molecular response mechanism. PMID: 30012607
  4. Data suggested that adenosine A1 receptor might potentiate glycinergic transmission through Galphai/PKA/alpha3 and Gbetagamma/alpha1ins pathways in inflamed rat. PMID: 28882563
  5. Elevated A1 adenosine receptor is associated with sleep deprivation. PMID: 28373571
  6. Mutation in ADORA1 may be associated with early-onset parkinsonism and cognitive dysfunction. PMID: 27134041
  7. Inhibition of cholinergic neurotransmission by beta3-adrenoceptors results from adenosine release via equilibrative nucleoside transporters and prejunctional A1-receptor stimulation in urinary bladder. PMID: 28446460
  8. This study showed that increased neuronal A1R expression in Rasmussen Encephalitis may be involved in prevention of seizures spread and seizures-induced damage, limitation of both seizures and inflammation atrophy in 1 cerebral hemisphere. PMID: 28789481
  9. A1R signaling enhances A2AR-mediated neurodegeneration [review] PMID: 28441750
  10. Mutational and computational analysis of A1-AR revealed a distinct conformation of the second extracellular loop and a wider extracellular cavity with a secondary binding pocket that can accommodate orthosteric and allosteric ligands. PMID: 28235198
  11. second extracellular loop is a key allosteric ligand-binding determinant. PMID: 27683013
  12. this study highlights a key role for extracellular loop 2 in A1AR orthosteric ligand binding and receptor activation. PMID: 27683014
  13. Dysregulation in ADORA1/ADORA2A expression was associated with glioma development. PMID: 27038930
  14. A1R mRNA levels and A1R density in PBMCs from idiopathic normal-pressure hydrocephalus patients were significantly lower than control subjects PMID: 26810542
  15. Its central activation could be and approach to achieving a shifted homeostasis in which physiology is downregulated to a homeostatically-regulated, stable hypometabolic state. (review) PMID: 27333659
  16. In postmortem human prefrontal cortex, adenosine A1 receptor is coupled preferentially, if not exclusively, to Galphai-3. PMID: 26213104
  17. Results show that ADORA1 rs2228079 and ADORA2A rs5751876 polymorphisms are associated with the risk of Gilles de la Tourette Syndrome, co-morbid disorders, and may affect the age of tics onset in Polish population. PMID: 26317759
  18. It has the intrinsic ability to form a heteromeric complex with metabotropic glutamate receptor type 1 and mutually modulate signaling. PMID: 26154847
  19. Paeoniflorin promotes the survival of cultured cortical neurons by increasing Akt and ERK1/2 phosphorylation via A1R-mediated transactivation of EGFR. PMID: 25661317
  20. Adenosine A1 receptor activation increases ENT1 activity via protein kinase C. PMID: 25725289
  21. This study revealed variation of regional A1AR availability associated with ADORA1 and particularly ADORA2A SNPs, several of which had previously been shown to be associated with increased anxiety and panic disorder. PMID: 24943643
  22. Stimulation of A1AR and A2BAR had a prominent anti-proliferative/pro-apoptotic effect on the glioblastoma stem cells. PMID: 25429616
  23. Results document that endogenously formed adenosine can chaperone its cognate A1 receptor. PMID: 25354767
  24. Results suggest that the anti-cancer effect of Omega-3 polyunsaturated fatty acids (Omega-3 PUFAs) on gastric cancer is at least partly dependent on activating the ADORA1-mediated apoptosis pathway. PMID: 24896321
  25. regulation of GABA uptake occurs via modulation of the GABA transporters by the adenosine A1 (A1R) and A2A (A2AR) receptors PMID: 23657626
  26. Induction of renal proximal tubular IL-11 is a critical intermediary in A1 adenosine receptor-mediated renal protection against acute ischemic kidney injury. PMID: 23813214
  27. Adenosine regulates bone metabolism via A1, A2A, and A2B receptors. PMID: 23682121
  28. Imiquimod suppresses propagation of herpes simplex virus 1 by upregulation of cystatin A via the adenosine receptor A1 pathway PMID: 22787201
  29. A1/A2 adenosine receptor activation does not directly contribute to cutaneous active vasodilatation. PMID: 22356216
  30. A(1) and A(2B)ARs could be potential biomarkers able to provide an early indication of SA risk and their stimulation may turn out to improve fetoplacental perfusion by increasing vascular endothelial growth factor (VEGF) and nitric oxide (NO). PMID: 22867902
  31. In patients with stable angina ADORA1 agonist capadenoson lowers exercise heart at comparable maximum workload, which is associated with improved total exercise time and prolongation of time to ischaemia. PMID: 22370739
  32. Results indicate a role for adenosine receptor A1 and A2A gene polymorphisms in susceptibility to apnoea of prematurity and bronchopulmonary dysplasia and in interindividual variability to caffeine response. PMID: 22462821
  33. Data suggest that expression of ADORA1 is too low to play a major role in regulation of lipogenic gene expression in hepatocytes; studies include investigation of gene expression under influence of ADORA1 agonists. PMID: 22449383
  34. data show that expression of A1Rs induced adipocyte differentiation, whereas A2bR expression inhibited adipogenesis and stimulated an osteoblastic phenotype PMID: 21730968
  35. AMP and a non-hydrolyzable AMP analog (deoxyadenosine 5'-monophosphonate, ACP) directly activated the adenosine A(1) receptor PMID: 22215671
  36. Inhibition of human mast cell activation would be a mechanism for A AR antagonists, but not A(2B) AR antagonists. PMID: 21506953
  37. Adenosine receptor expression and activation during the differentiation of mesenchymal stem cell to osteoblasts and adipocytes, was investigated. PMID: 21590734
  38. two genes involved in cardiovascular diseases, ADORA1 and PTGDS, were differentially up-regulated in epicardial adipose tissue compared to mediastinal and subcutaneous adipose tissue PMID: 21603615
  39. Data suggest that adenosine deficiency may be relevant to human epilepsy and that a ketogenic diet can reduce seizures by increasing adenosine A1 receptor-mediated inhibition. PMID: 21701065
  40. ADORA1 was expressed in nucleus, perinucleus and cytoplasm of retinal pigment epithelium. PMID: 21542986
  41. report implicating genetic variability in the A1AR with post-traumatic seizures. PMID: 20609566
  42. LUF5834 represents a novel high affinity radioligand for the A(1)R and may prove a useful tool to provide estimates of inverse agonist efficacy at this receptor. PMID: 20599769
  43. results suggest that adenosine-mediated signaling in the heart requires a balance between A(1)- and A(2A)-receptors PMID: 20354569
  44. Report fluorescence-based techniques, and in particular the development of fluorescent ligands, so study pharmacology of the adenosine A1 receptor. PMID: 20105183
  45. Findings suggest that the adenosine A1 (and possibly coordinated with A2a) receptors contribute to dendritic cell differentiation and survival. PMID: 20085598
  46. Studies indicate that adenosine mediates its actions by means of activation of specifiic G protein-coupled receptors, for which 4 subbtypes: A1R, A2AR, A2BR and A3R have been identified so far. PMID: 19883624
  47. Adenosine, thus, suppresses CW2 human colonic cancer growth by inducing apoptosis as mediated via A(1) adenosine receptors. PMID: 19822392
  48. Data suggest that adenosine receptor modulation may be useful for refining the use of chemotherapeutic drugs to treat human cancer more effectively. PMID: 19794965
  49. ADORA1 polymorphisms may represent good candidate markers for schizophrenia research and ADORA1 may be involved in the pathophysiological mechanisms of schizophrenia in Japanese populations PMID: 19820430
  50. Human A1 adenosine receptor overexpressed in adipose tissue of transgenic mice protects them from obesity-related insulin resistance. PMID: 11703426

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links

HGNC: 262

OMIM: 102775

KEGG: hsa:134

STRING: 9606.ENSP00000308549

UniGene: Hs.77867

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*