Recombinant Human C-C chemokine receptor type 10 (CCR10)

Code CSB-CF004840HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
CCR10; GPR2; C-C chemokine receptor type 10; C-C CKR-10; CC-CKR-10; CCR-10; G-protein coupled receptor 2
Species
Homo sapiens (Human)
Expression Region
1-362
Target Protein Sequence
MGTEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQPSVSLTVAALGLAGNG LVLATHLAARRAARSPTSAHLLQLALADLLLALTLPFAAAGALQGWSLGSATCRTISGLY SASFHAGFLFLACISADRYVAIARALPAGPRPSTPGRAHLVSVIVWLLSLLLALPALLFS QDGQREGQRRCRLIFPEGLTQTVKGASAVAQVALGFALPLGVMVACYALLGRTLLAARGP ERRRALRVVVALVAAFVVLQLPYSLALLLDTADLLAARERSCPASKRKDVALLVTSGLAL ARCGLNPVLYAFLGLRFRQDLRRLLRGGSCPSGPQPRRGCPRRPRLSSCSAPTETHSLSW DN
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for chemokines SCYA27 and SCYA28. Subsequently transduces a signal by increasing the intracellular calcium ions level and stimulates chemotaxis in a pre-B cell line.
Gene References into Functions
  1. CCR10 may be a key regulator in breast cancer cell invasion and migration PMID: 28830025
  2. CCR10/CCL27 crosstalk mediated drug resistance, contributing to failure of proteasome-inhibitors in multiple myeloma. PMID: 27732933
  3. CCL27 drives baseline recruitment of Herpes simplex virus-specific CD8 T cells expressing CCR10, while interferon-responsive CXCR3 ligands recruit additional cells in response to virus-driven inflammation. PMID: 28701399
  4. The chemokine receptor CCR10 is highly expressed in human glioblastoma compared with control brain tissue. PMID: 25149529
  5. Findings support the notion that CCR10 and its ligand CCL27 may contribute to the skin infiltration of malignant T-cells in mycosis fungoides and adult T-cell leukemia/lymphoma. PMID: 24970722
  6. low CCL27/CCR10 and CXCL12/CXCR4 intratumoral mRNA ratios are associated with melanoma progression PMID: 22526457
  7. CCR7 overexpression correlated with expression of metallothionein, while CCR10 was associated with cerebral metastases. CCR7 and CCR10 overexpressions were associated with a worse outcome independent of Breslow's tumor thickness and Clark level. PMID: 22350183
  8. unlike blood plasmacytoid dendritic cells (pDCs), a subset of tonsil pDCs express functional CCR6 and CCR10, and their respective ligands CCL20 and CCL27 are detected in inflamed epithelia PMID: 21937703
  9. The high fraction of circulating IgA+ and IgG+ B cells expressing CCR9 and CCR10 in the first months of life indicates activation of naive B cells in the gut, coinciding with bacterial colonization. PMID: 21075690
  10. TLR2 ligands induce CCR9 and CCR10 expression by circulating B-cells and increase their chemotaxis. TLR2 stimulation also induced J chain and IgA production demonstrating the induction of mucosal-like antibody secreting cells. PMID: 20947433
  11. CCR10 and its ligand CCL27 may contribute to the skin infiltration of malignant T-cells in cutaneous T-cell lymphoma. PMID: 15700309
  12. gene expression of CCR10 was increased by recombinant ANXA1 and the N-terminal ANXA1 peptide PMID: 16460738
  13. CCR10-CTACK/CCL27 interactions between circulating T cells and keratinocytes would seem to play an important role in the pathophysiology of mycosis fungoides. PMID: 16675558
  14. CCR10 allows T regulatory (Treg) cells recruited to chronically inflamed liver tissues to respond to CCL28 secreted by epithelial cells, resulting in the accumulation of CCR10+ Tregs at mucosal surfaces. PMID: 16785557
  15. CCR4 and CCR10 may play an important role in ATLL invasion into the skin PMID: 17071491
  16. CCR4 and CCR10 are expressed on epidermal keratinocytes and that both are functional in terms of skin cytokine production and/or migration to their ligand CCL17 and CCL27, respectively. PMID: 18782672

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed at high levels in adult testis, small intestine, fetal lung, fetal kidney. Weaker expression was observed in many other adult tissues including spleen, thymus, lymph node, Peyer patches, colon, heart, ovary, peripheral blood lymphocytes, thyroid
Database Links

HGNC: 4474

OMIM: 600240

KEGG: hsa:2826

STRING: 9606.ENSP00000332504

UniGene: Hs.744542

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1