Recombinant Human C-X-C chemokine receptor type 5(CXCR5)

Code CSB-CF006255HU
Size Pls inquire other sizes
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names CXCR5
Uniprot No. P32302
Alternative Names BLR 1; BLR1; Burkitt lymphoma receptor 1; Burkitt lymphoma receptor 1 GTP binding protein; Burkitt lymphoma receptor 1; GTP binding protein (chemokine (C-X-C motif) receptor 5); C X C chemokine receptor type 5; C-X-C chemokine receptor type 5; CD 185; CD185; CD185 antigen; Chemokine (C-X-C motif) receptor 5; Chemokine C X C motif receptor 5; Chemokine CXC motif receptor 5; Chemokine receptor 5; CXC chemokine receptor type 5; CXC R5; CXC-R5; CXCR 5; CXCR-5; Cxcr5; CXCR5_HUMAN; MDR 15; MDR-15; MDR15; MGC117347; Monocyte derived receptor 15; Monocyte-derived receptor 15
Species Homo sapiens (Human)
Expression Region 1-372
Target Protein Sequence MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVPVAYSL IFLLGVIGNVLVLVILERHRQTRSSTETFLFHLAVADLLLVFILPFAVAEGSVGWVLGTF LCKTVIALHKVNFYCSSLLLACIAVDRYLAIVHAVHAYRHRRLLSIHITCGTIWLVGFLL ALPEILFAKVSQGHHNNSLPRCTFSQENQAETHAWFTSRFLYHVAGFLLPMLVMGWCYVG VVHRLRQAQRRPQRQKAVRVAILVTSIFFLCWSPYHIVIFLDTLARLKAVDNTCKLNGSL PVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQLFPSWRRSSL SESENATSLTTF
Protein Length Full length protein
Tag Info The following tags are available.
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Target Data

Function Cytokine receptor that binds to B-lymphocyte chemoattractant (BLC). Involved in B-cell migration into B-cell follicles of spleen and Peyer patches but not into those of mesenteric or peripheral lymph nodes. May have a regulatory function in Burkitt lymphoma (BL) lymphomagenesis and/or B-cell differentiation.
Gene References into Functions
  1. miR-192 suppresses T follicular helper cell differentiation by targeting CXCR5 in childhood asthma. PMID: 29490514
  2. basal CXCR5(+)Th17 cell frequency may indicate underlying differences in disease phenotype between patients and predict ultimate success of TNF inhibitor therapy PMID: 28004828
  3. The A allele of rs613791 and G allele of rs523604 located in CXCR5 were observed to be significantly associated with vitiligo in the Chinese Han population. PMID: 28551095
  4. These results provide clear evidence that CXCR4- or CCR5-beta-arrestin complexes induce receptor endocytosis and signaling in the absence of G protein coupling and ligand-induced conformational changes of the receptor. PMID: 28733085
  5. these findings demonstrate that CXCR5 overexpression increases the ability of MSCs to respond to migratory stimuli and highly intensifies their immunomodulatory effects in vivo. This strategy for enhancing targeted stem/progenitor cell homing may improve the efficacy of MSC-based therapies. PMID: 28454789
  6. all three p53 family members mediate the effects of genotoxic stress on the CXCR5 promoter using the same mechanism associated with attenuation of NFkB activity. PMID: 29107083
  7. identified the miR-19a/CXCR5 pathway as a candidate p53-induced migration mechanism PMID: 28783539
  8. CXCL13/CXCR5 mediated the aggregation of B cells, that directed the aberrant humoral immune responses via the formation of ectopic germinal centers, which suggests a molecular mechanism of neurological damage in neurosyphilis. PMID: 28931218
  9. the data demonstrate that CXCR5(+)CD8(+) T cells represent a significant CD8(+) T cell subset in colorectal tumors and have the potential to contribute to antitumor immunity, but their specific roles require further studies in vivo. PMID: 28412245
  10. we demonstrate that PKCepsilon cooperates with the loss of the tumor suppressor Pten for the development of prostate cancer in a mouse model. Mechanistic analysis revealed that PKCe overexpression and Pten loss individually and synergistically upregulate the production of the chemokine CXCL13, which involves the transcriptional activation of the CXCL13 gene PMID: 28402859
  11. Levels of CXCR5 mRNA and protein levels were up-regulated in brain from temporal lobe epilepsy patients. PMID: 27873133
  12. Neoplastic cells of PCSM-TCL are medium- to-large-sized T cells with cerebriform nuclei, which lack the expression of TFH-cell defining chemokine receptor CXCR5. These features are highly distinctive and can be invaluable in separating this rather indolent cutaneous T-cell lymphoid neoplasm from more aggressive lymphomas of TFH-cell phenotype, including primary cutaneous TFH-cell lymphoma and skin involvement of AITL PMID: 26928629
  13. CXCR5 expression positively related to the lymph node and distal metastasis, tumor stage and relapse of colorectal cancer. PMID: 25726157
  14. In patients with HBV-related hepatocellular carcinoma the phenotype and function of CXCR5+CD45RA-CD4+ T cells were altered. PMID: 26517519
  15. HCV infection increased the frequency of CD4+CXCR5+ T cells and decreased the frequency of CD27+IgG+ B cells. CD4+CXCR5+ T cells activated CD27+IgG+ B cells via the secretion of IL-21. PMID: 26818544
  16. Authors demonstrate that CD40 expression upregulates the chemokine receptor CXCR5 and promotes MDSC migration toward and accumulation within cancer. PMID: 26462153
  17. down-regulation of CXCR5 inhibited the growth and proliferation of LNCaP cells. PMID: 26640404
  18. findings reveal a neuronal/astrocytic interaction in the spinal cord by which neuronally produced CXCL13 activates astrocytes via CXCR5 to facilitate neuropathic pain. PMID: 26752644
  19. Circulating CXCR5+CD4+helper T cells in systemic lupus erythematosus patients share phenotypic properties with germinal center follicular helper T cells and promote antibody production. PMID: 25654980
  20. study showed that induction of circulating CXCR5+CD4+ Tfh-like subsets can be detected following immunization with HPV vaccines, and potentially be useful as a marker of immunogenicity of vaccines PMID: 26333070
  21. A negative correlation between levels of miR-346 and percentages of CD4(+)CXCR5(+) T cells was confirmed in Graves' disease PMID: 25666935
  22. IL-33 enhances humoral immunity against chronic hbv infection through activating CD4(+)CXCR5(+) helper-Inducer T-Lymphocytes. PMID: 25714983
  23. elevated CXCR5 expression may contribute to abnormal cell survival and migration in breast tumors that lack functional p53. PMID: 25786345
  24. our findings suggest that CXCL13-CXCR5 axis promotes the growth, migration, and invasion of colon cancer cells, probably via PI3K/AKT pathway PMID: 25476740
  25. After validation in larger patient groups, CXCR5 and CXCL13 may prove useful as biomarkers for nonsmall cell lung carcinoma Correspondingly, blockade of this axis could serve as an effective therapy for nonsmall cell lung carcinoma. PMID: 25271023
  26. FANCA-modulated neddylation pathway involved in CXCR5 membrane targeting and cell mobility. PMID: 25015289
  27. three SNPs (rs497916, rs3922, rs676925) in CXCR5 and one SNP (rs355687) in CXCL13 were associated with hepatitis B vaccine efficacy PMID: 25077417
  28. specific G protein isoforms coupled to CXCR5 in its resting and active states, were identified. PMID: 23773523
  29. Expression features of CXCR5 and its ligand, CXCL13 associated with poor prognosis of advanced colorectal cancer PMID: 25010623
  30. CD4+CXCR5+ helper T cells may contribute to the pathogenesis of primary Sjogren's syndrome by promoting the maturation of B cells. PMID: 24966908
  31. Suggest that platelet-mediated signaling through CXCR5 may be active in vivo during plaque destabilization, enhancing the anti-inflammatory effects of CXCL13. PMID: 24732574
  32. healthy controls with rs6421571CT and TT genotypes had higher mRNA and protein levels of CXCR5 than those with wild-type CC genotype specifically in CD4+ T cells PMID: 24833093
  33. 11q23.3 with rs4938573 near CXCR5 gene is associated with follicular lymphoma. PMID: 25279986
  34. expression of CXCR5 was significantly associated with both stage and lymph node metastasis, but not with tumor size, tumor differentiation grade, or menopausal status of the patient. PMID: 24337540
  35. study discovered multiple susceptibility variants for systemic lupus erythematosus in the 11q23.3 region, including variants in/near PHLDB1 (rs11603023), DDX6 (rs638893) and CXCR5 (rs10892301) PMID: 24001599
  36. Results provide additional evidence for a role of host genetic variation in CXCR5 in lymphomagenesis, particularly for FL. PMID: 23812490
  37. Data suggest the involvement of CD4+ CXCR5+ T cells (circulating follicular helper T cells Tfh) in the pathogenesis and progression of chronic lymphocytic leukemia (CLL). PMID: 23807677
  38. Circulating precursor cd4+ T cells expressing CCR7(low)PD-1(high) CXCR5+ indicate T-helper cell activity and promote antibody responses upon antigen re-exposure. PMID: 24138884
  39. Human circulating memory T-helper cells expressing PD-1 and CXCR5 are highly functional and correlate with broadly neutralizing HIV antibody responses. PMID: 24035365
  40. A single nucleotide polymorphism in CXCR5, rs630923, is associated with genetic risk for multiple sclerosis. PMID: 23739915
  41. Polymorphisms in CXCR5 are associated with HIV-associated non-hodgkin B-cell lymphoma. PMID: 23250934
  42. Interruption of CXCL13-CXCR5 axis increases upper genital tract pathology and activation of NKT cells following chlamydial genital infection. PMID: 23189125
  43. Data indicate that EBI2 expression modulates CXCL13 binding affinity to CXCR5. PMID: 22913878
  44. Levels of CXCL13 are increased in carotid atherosclerosis both systemically and within the atherosclerotic lesion. Based on our in vitro findings, we hypothesize a potential plaque stabilizing effects of CXCL13-CXCR5 interaction PMID: 22840692
  45. C-X-C chemokine receptor type 5 gene polymorphisms are associated with non-Hodgkin lymphoma. PMID: 22707196
  46. The CXCL13-CXCR5 axis is associated with classic determinants of poor prognosis, such as high grade, hormone receptor negativity, and axillary node involvement. PMID: 22607768
  47. Sections of the mouse CXCR5 intron significantly align plus/plus with sections of the human intron; the aligned segments are in the same order in mouse as in man and overall cover 13% of the mouse sequence and 17% of the human sequence. PMID: 20809769
  48. Data indicate that the percentages of CD4(+)CXCR5(+) TFH in IA patients were positively correlated with AST. PMID: 21750724
  49. these results add new information about the CXCL13-CXCR5 axis in neuroblastic tumors and in the crosstalk between neuroblastic and stromal cells. PMID: 21642390
  50. Central memory CD4 T cells expressing CXCR5 efficiently induced PC differentiation and Ig secretion, and displayed a different profile in terms of cytokine and costimulatory molecule expression. PMID: 21471443
  51. CXCL13 caused CXCR5-dependent activation of the PI3Kp85alpha in prostate cancer cells PMID: 20412587
  52. Results suggest that BLC/CXCL13 as well as its corresponding receptor, CXCR5, may play important roles in the pathogenesis of SLE and in lupus nephritis. PMID: 19955043
  53. structural requirements for the activation of signal transduction pathways by CXCR5 PMID: 11688722
  54. CXCR5 is a common and early marker for newly generated memory CD4+ T cell subsets during ongoing immune responses. PMID: 11714765
  55. Most Natural killer t-cells express receptors for extralymphoid tissue or inflammation-related chemokines (CCR2, CCR5, and CXCR3), while few NKT cells express lymphoid tissue-homing chemokine receptors (CCR7 and CXCR5). PMID: 12070001
  56. Data show that blr1 was induced early during cell differentiation and because its overexpression accelerated monocytic differentiation, it may be important for signals controlling cell differentiation. PMID: 12324654
  57. Data demonstrate a significant age-dependent difference in the response of osteoblasts to CXCR3 and CXCR5 activation. PMID: 14618028
  58. CXCR5 and CXCL13 play an essential role in maintaining B- and T-cells in lymphocytic infiltrates and ectopic follicles in thyroid tissue from patients affected by autoimmunity. PMID: 14763921
  59. studies suggest that IRBP and S-Ag can initiate innate and, in sensitive individuals, adaptive immune response by attracting iDCs and T and B cells expressing CXCR3 and CXCR5 PMID: 15713799
  60. Potenetial role of CXCL13 and its specific receptor CXCR5 in recruitment of B cells in renal allograft rejection. PMID: 15780119
  61. Data show that CXCL13 and CCL19 together by means of activation of CXCR5 and CCR7 up-regulated PEG10 expression and function in leukemic B cells. PMID: 16225771
  62. elevated levels of CXCL13 could cause impaired or altered trafficking of B cells during HIV infection and could contribute to the previously reported loss of CXCR5 PMID: 16318584
  63. CCR7 and CXCR5 are differentially expressed on the cell surface of lymphocytes and dendritic cells depending of the stage of cellular differentiation and activation. (review) PMID: 16888899
  64. expression of CXCR5 identifies a unique subset of Vgamma9Vdelta2 T cells which express the costimulatory molecules ICOS and CD40L, secrete IL-2, IL-4, and IL-10 and help B cells for Ab production PMID: 17015714
  65. Expression of CXCR5 on tumor cells promotes the growth of colon carcinoma cells in the liver. PMID: 17018614
  66. CXCR5 plays a role in Chronic lymphocytic leukemia (CLL) cell positioning and cognate interactions between CLL and CXCL13-secreting CD68+ accessory cells in lymphoid tissues. PMID: 17652619
  67. CXCR5 is the first chemokine receptor so far identified able to attract in vitro primary metastatic neuroblastoma cells PMID: 17786442
  68. Most B cells expressed CXCR5. PMID: 18528326
  69. Altered expression of the chemokine receptor-ligand pair, CXCR5/CXCL13, may participate in the establishment of B-cell dysfunctions during HIV-1 infection. PMID: 18780835
  70. High levels of CXCR5 is associated with mantle cell lymphoma. PMID: 19228923
  71. the CXCL13-CXCR5 axis is significantly associated with prostate cancer progression PMID: 19375853
  72. Low-expression frequency for the chemokine receptor CXCR5 is associated with mediastinal large B-cell lymphoma. PMID: 19536742
  73. Overexpression of CXCR5 is associated with prostate cancer. PMID: 19610059

Show More

Hide All

Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expression in mature B-cells and Burkitt lymphoma cells.
Database Links

HGNC: 1060

OMIM: 601613

KEGG: hsa:643

STRING: 9606.ENSP00000292174

UniGene: Hs.113916

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1