Recombinant Human Claudin-6 (CLDN6), partial

In Stock
Code CSB-CF005508HU
Abbreviation Recombinant Human CLDN6 protein, partial
MSDS
Size $878
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Microbiology
Alternative Names
CLDN6; UNQ757/PRO1488; Claudin-6; Skullin
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-82aa
Target Protein Sequence
MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.8kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Recombinant Human Claudin-6 (CLDN6) is a high-purity, bacterially expressed protein fragment designed for applications in microbiology research. Produced in an in vitro E. coli expression system, it corresponds to amino acids 1-82 of human CLDN6 and is fused with an N-terminal 6xHis-SUMO tag. A key advantage of this product is its exceptional purity (>90% as verified by SDS-PAGE), demonstrated by a single, sharp band near the 25.0 kDa marker in the gel image, ensuring reliable and consistent performance. The defined partial sequence (1-82aa) offers a focused tool for studying specific extracellular domains or functional regions of CLDN6. This ready-to-use reagent is an ideal standardized antigen for antibody development. And specificity validation, or mechanistic studies related to CLDN6's role in microbial pathogenesis or host-pathogen interactions, should first undergo preliminary experimental verification.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a major role in tight junction-specific obliteration of the intercellular space.; (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells.
Gene References into Functions
  1. Antibodies recognizing native CLDN6 as displayed on cell surfaces and mediating complement-dependent cytotoxicity were elicited in vaccinated animals. The data suggest applications of CLDN6 displaying Virus-like particles in cancer immunotherapy. PMID: 29131519
  2. these results suggest that Helicobacter pylori lipopolysaccharide induces TLR2 expression in the gastric adenocarcinoma cells, and that the longer the exposure to lipopolysaccharide, the greater the expression of TLR2 in the cell membrane; consequently the expression of claudin-4, -6, -7 and -9 also increases PMID: 29031421
  3. Study provides evidence that high expression of CLDN6 confers chemoresistance on breast cancer which is mediated by GSTP1, the activity of which is regulated by p53. PMID: 29116019
  4. CLDN6 enhances the chemoresistance to ADM via activating the AF-6/ERK signaling pathway and up-regulating cancer stem cell characters in MDAMB231 cells. PMID: 29159771
  5. we demonstrated that the downregulation of CLDN6 is regulated through promoter methylation by DNMT1, which depends on the SMAD2 pathway, and that CLDN6 is a key regulator in the SMAD2/DNMT1/CLDN6 pathway to inhibit EMT, migration and invasion of breast cancer cells PMID: 28867761
  6. In conclusion, this information from bioinformatics analysis will help future attempts to better understand CLDN6 regulation and functions. PMID: 28656265
  7. high expression of CLDN 6 was observed in approx. 65% of the myxofibrosarcomas, whereas the benign soft tissue tumors did not show a high expression of CLDN 6. The expression of CLDN 6 in the myxofibrosarcomas was significantly higher than those of other tumor specimens. Among the myxofibrosarcomas, the high expression of CLDN 6 was correlated with high FNCLCC grades and high AJCC stages. PMID: 28476380
  8. Results show that DNA methylation down-regulates CLDN6 expression through MeCP2 binding to the CLDN6 promoter, deacetylating H3 and H4, and altering chromatin structure, consequently promoting migratory and invasive phenotype in breast cancer cells. PMID: 27461117
  9. Cldn6 was decreased in alveolar type II-like epithelial cells (A549) and primary small airway epithelial cells when exposed to cigarette smoke ext PMID: 27982694
  10. suggest that claudin-6 induces MMP-2 activation through claudin-1 membrane expression PMID: 27914788
  11. Data show that claudin-6 (CLDN6) R209Q and occludin (OCLN) P24A mutations do not affect HCV pseudoparticles (HCVpp) entry. PMID: 26561856
  12. The expression of ASK1 is correlated with the level of claudin-6 in cervical carcinoma cells and tissues. PMID: 26191261
  13. High levels of CLDN6 are associated with non-small-cell lung cancer. PMID: 24710653
  14. The expression of claudin-6 was down regulated in gastric cancer tissue. PMID: 23919729
  15. Only some hepatitis C virus strains efficiently use CLDN6 for infection. PMID: 23775920
  16. This work provides a proof of concept for the use of Claudin-6 to eliminate residual undifferentiated human pluripotent stem cells from culture. PMID: 23778593
  17. Although claudin-6 and claudin-9 can serve as entry factors in cell lines, hepatitis C virus infection into human hepatocytes is not dependent on claudin-6 and claudin-9. PMID: 23864633
  18. ASK1 signal may play a positive role in the inhibitory effect of claudin-6 in breast cancer. PMID: 22925655
  19. Our results show that claudin-6 protein is significantly down-regulated in breast invasive ductal carcinomas PMID: 22455563
  20. CLDN6 is not a specific biomarker for atypical teratoid rhabdoid tumors as it is expressed in a variety of other pediatric CNS and soft tissue tumors. PMID: 21989342
  21. 17beta-E2 might regulate the expression of claudin-6 and inhibit the proliferation and migration of MCF-7 cells. PMID: 20388399
  22. Increased expression of claudin-6, claudin-7, or claudin-9 is sufficient to enhance tumorigenic properties of a gastric adenocarcinoma cell line. PMID: 20874001
  23. CLDN6 may be a useful positive marker to help further identify atypical teratoid/rhabdoid tumors for diagnostic and treatment purposes PMID: 19220299
  24. Claudins 6, 7, and 9 expressions are closely related to gastric carcinogenesis PMID: 19960275
  25. The up-regulation of claudin-6 expression in MCF-7 breast cancer cells suppresses their malignant phenotypes with a correlation with the restoration of tight junction integrity. PMID: 20367941
  26. claudin-6, downregulates the malignant phenotype of breast carcinoma. PMID: 20215972
  27. Claudin 6 was not found in epithelioid glioblastomas or rhabdoid glioblastomas. PMID: 20118769
  28. CLDN6 and CLDN9, but not CLDN1, are expressed in peripheral blood mononuclear cells, an additional site of HCV replication. PMID: 17804490
  29. claudin-6 and claudin-9 expressed in CD81+ cells also enable the entry of HCV pseudoparticles derived from six of the major genotypes. PMID: 18234789
  30. CLDN6, clustered with CLDN9 at human chromosome 16p13.3, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C. PMID: 12736707

Show More

Hide All

Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Protein Families
Claudin family
Tissue Specificity
Expressed in the liver, in peripheral blood mononuclear cells and hepatocarcinoma cell lines.
Database Links

HGNC: 2048

OMIM: 615798

KEGG: hsa:9074

STRING: 9606.ENSP00000328674

UniGene: Hs.533779

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*