Recombinant Human Claudin-6(CLDN6),partial

In Stock
Code CSB-CF005508HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P56747
Lead Time 3-7 business days
Relevance Plays a major role in tight junction-specific obliteration of the intercellular space (By similarity). May act as a coreceptor for HCV entry into hepatic cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARA
Research Area Microbiology
Source in vitro E.coli expression system
Gene Names CLDN6
Protein Names Skullin
Expression Region 1-82aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 24.8kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays a major role in tight junction-specific obliteration of the intercellular space.
Subcellular Location Cell junction, tight junction, Cell membrane, Multi-pass membrane protein
Protein Families Claudin family
Tissue Specificity Expressed in the liver, in peripheral blood mononuclear cells and hepatocarcinoma cell lines.
Database Links

HGNC: 2048

OMIM: 615798

KEGG: hsa:9074

STRING: 9606.ENSP00000328674

UniGene: Hs.533779

Related Products

CLDN6 Antibodies

CLDN6 Antibodies for Homo sapiens (Human)

CLDN6 Antibodies for Human

CLDN6 Proteins

CLDN6 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.