Recombinant Human D(2) dopamine receptor(DRD2)

Code CSB-CF007179HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P14416
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
Source in vitro E.coli expression system
Gene Names DRD2
Protein Names Recommended name: D(2) dopamine receptorAlternative name(s): Dopamine D2 receptor
Expression Region 1-443
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

HGNC: 3023

OMIM: 103780

KEGG: hsa:1813

STRING: 9606.ENSP00000354859

UniGene: Hs.73893

Pathway cAMP signaling pathway
Gap junction
Rap1 signaling pathway

Related Products

DRD2 Antibodies

DRD2 Antibodies for Homo sapiens (Human)

DRD2 Proteins

DRD2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.