Recombinant Human Podoplanin(PDPN)

Code CSB-CF017739HU(A4)
Product Type Transmembrane Protein
Size $546
Uniprot No. Q86YL7
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence ASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP
Source in vitro E.coli expression system
Gene Names PDPN
Expression Region 23-162
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mediates effects on cell migration and adhesion through its different partners. During development plays a role in blood and lymphatic vessels separation by binding CLEC1B, triggering CLEC1B activation in platelets and leading to platelet activation and/or aggregation
Subcellular Location Podoplanin: Membrane, Single-pass type I membrane protein, Cell projection, lamellipodium membrane, Single-pass type I membrane protein, Cell projection, filopodium membrane, Single-pass type I membrane protein, Cell projection, microvillus membrane, Single-pass type I membrane protein, Cell projection, ruffle membrane, Single-pass type I membrane protein, Membrane raft, Apical cell membrane, Basolateral cell membrane, Cell projection, invadopodium
Protein Families Podoplanin family
Tissue Specificity Highly expressed in placenta, lung, skeletal muscle and brain. Weakly expressed in brain, kidney and liver. In placenta, expressed on the apical plasma membrane of endothelium. In lung, expressed in alveolar epithelium. Up-regulated in colorectal tumors a
Database Links

HGNC: 29602

OMIM: 608863

KEGG: hsa:10630

STRING: 9606.ENSP00000294489

UniGene: Hs.468675

Related Products

PDPN Antibodies

PDPN Antibodies for Human

PDPN Antibodies for Homo sapiens (Human)

PDPN Proteins

PDPN Proteins for Homo sapiens (Human)

PDPN ELISA Kit

PDPN ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.