Recombinant Human Sodium/potassium-transporting ATPase subunit beta-1 (ATP1B1)

Code CSB-CF002326HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
ATP1B1; ATP1B; Sodium/potassium-transporting ATPase subunit beta-1; Sodium/potassium-dependent ATPase subunit beta-1
Species
Homo sapiens (Human)
Expression Region
1-303
Target Protein Sequence
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane.; Involved in cell adhesion and establishing epithelial cell polarity.
Gene References into Functions
  1. Novel Single Nucleotide Polymorphism at ATP1B1 implicate gene regulatory dysfunction in QT prolongation in African and Hispanic Americans. PMID: 27988371
  2. the ratio between FXYD5 and alpha1-beta1 heterodimer determines whether the Na,K-ATPase acts as a positive or negative regulator of intercellular adhesion. PMID: 27142834
  3. Our study describes the potent inhibition of Chikungunya virus and related alphaviruses by the cardiac glycoside digoxin and demonstrates a function for the sodium-potassium ATPase in Chikungunya virus infection. PMID: 27222471
  4. Expression of miR-26a and miR-29a was significantly down regulated in leukoplakia and cancer tissues but up regulated in lichen planus tissues. Expression of target genes such as, ADAMTS7, ATP1B1, COL4A2, CPEB3, CDK6, DNMT3a and PI3KR1 was significantly down regulated in at least two of three disease types with respect to normal tissues. PMID: 27515006
  5. Overexpression of ATP1B1 is associated with cytogenetically normal acute myeloid leukemia. PMID: 26506237
  6. Na,K-ATPase b1-subunit is a target of the Shh signaling pathway and loss of b1-subunit expression may contribute to tumor development and progression not only in carcinoma but also in medulloblastoma, a tumor of neuronal origin. PMID: 26286140
  7. Impaired regulation and compromised activity of ion channel proteins contribute to the pathophysiology of vascular dementia. PMID: 25152327
  8. Activities of AE1 and the sodium pump are coregulated in kidney. PMID: 25012180
  9. ATP1B1 is epigenetically silenced by promoter methylation in both renal cell carcinoma (RCC) patients' tissues and cell lines. PMID: 24452105
  10. A polymorphic 3'UTR element in ATP1B1 regulates alternative polyadenylation and is associated with blood pressure. PMID: 24098465
  11. Changes were found in mRNA and protein expressions of Na(+)/K(+)-ATPase subunits in LG from term pregnant rabbits and these changes suggest a role in the pregnancy-related LG secretion changes and dry eye symptoms observed in these animals. PMID: 23009595
  12. Data show that protein kinase A (PKA) phosphorylation has a drastic impact on Na(+)/K(+)-ATPase (NKA) structure and dynamics PMID: 22433860
  13. examined polymorphisms in three genes (ATP1B1, RGS5 and SELE) in relation to hypertension and blood pressure in a cohort of African-Americans PMID: 21881522
  14. interactions between the beta subunits of neighboring cells maintain integrity of intercellular junctions PMID: 21642423
  15. Na(+)-K(+) ATPase B1 can synergize with adriamycin and reverse drug resistance in MCF7 cells. PMID: 19664334
  16. Silencing of ATP1B1 gene can enhance the proliferation and migration capability of SGC-7901 adenocarcinoma cells. PMID: 19619434
  17. through its interaction with ATP1B1, MLC1 is involved in the control of intracellular osmotic conditions and volume regulation in astrocytes, opening new perspectives for understanding the pathological mechanisms of MLC disease. PMID: 20926452
  18. Data indicate that CypB through its interaction with Na/K-beta1 might regulate maturation and trafficking of the pump through the secretory pathway. PMID: 21085665
  19. Results identified that the beta1 subunit of the host Na(+)/K(+)-ATPase beta1 subunit (ATP1B1) interacts with the cytoplasmic domain of both the influenza A and B virus M2 and BM2 proteins. PMID: 21104370
  20. Data show that deglycosylation in polarized hepatic cells by drugs, or by site-directed mutagenesis of the N-linked-glycosylation residues, cause the Na+/K+-ATPase beta-subunit to traffic from the native basolateral to the apical/canalicular domain. PMID: 16339171
  21. these studies are indicative of a synergism between Sp1 and CREB in mediating regulation of Na-K ATPase beta1 subunit by PGRE3; while regulation occurring through PGRE1 also involves Sp1 and CREB. PMID: 16478973
  22. Study identifies an interaction between Wolframin and Na+/K+ ATPase beta1 subunit in transfected Cos7 cells, and between endogenous proteins in placental, neuroblastoma and MIN6 pancreatic beta-cell lines. PMID: 17947299
  23. E2A and Na/K-ATPase beta1 subunit expression in epithelial cells are regulated by interactions between these proteins. PMID: 18727914
  24. Reduced expression of the Na,K-beta(1) protein is associated with oxaliplatin resistance in cancer cells. PMID: 19322565
  25. Propose that kinase-dependent regulation of the Na(+)-K(+) pump occurs via glutathionylation of its beta(1) subunit (ATP1B1) at Cys46. PMID: 19542013
  26. ATP1B1 may confer susceptibility to BP regulation and hypertension in this Chinese population. PMID: 19563793
  27. Measured properties of the purified carboxy-terminal lobe suggest that the fragment is correctly folded and compatible with the proposed model of Na,K-ATPase beta1 subunit. PMID: 19694409
  28. Genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 19305409

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein. Apical cell membrane; Single-pass type II membrane protein. Cell membrane, sarcolemma.
Protein Families
X(+)/potassium ATPases subunit beta family
Tissue Specificity
Found in most tissues.
Database Links

HGNC: 804

OMIM: 182330

KEGG: hsa:481

STRING: 9606.ENSP00000356789

UniGene: Hs.291196

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1