Recombinant Mouse B-cell antigen receptor complex-associated protein alpha chain (Cd79a)

Code CSB-CF004957MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Cd79a; Iga; Mb-1; B-cell antigen receptor complex-associated protein alpha chain; Ig-alpha; MB-1 membrane glycoprotein; Membrane-bound immunoglobulin-associated protein; Surface IgM-associated protein; CD antigen CD79a
Species
Mus musculus (Mouse)
Expression Region
29-220
Target Protein Sequence
LRVEGGPPSLTVNLGEEARLTCENNGRNPNITWWFSLQSNITWPPVPLGPGQGTTGQLFFPEVNKNHRGLYWCQVIENNILKRSCGTYLRVRNPVPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKFGVDMPDDYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGNLHIGDAQLEKP
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B-cells.
Gene References into Functions
  1. BCR activation is accompanied by asymmetric conformational changes, possibly promoting the binding of Igalpha and Igbeta to differently localized signaling complexes PMID: 24244439
  2. CD79a myeloid cells showed enhanced ability to promote primary tumor growth and metastasis. PMID: 24146823
  3. Data indicate that in the absence of DGKzeta, the threshold for B cell antigen receptor (BCR) signaling, measured as activation of the Ras-extracellular signal-regulated kinase (ERK) pathway, was markedly reduced in mature follicular B cells. PMID: 24129701
  4. Data show that the B cell antigen receptor (BCR) and Igalpha may be required for B cell survival because they function as adaptor proteins in a BAFFR signaling pathway leading to activation of Syk, indicating crosstalk between the two receptors. PMID: 23453634
  5. The mouse B cell-specific mb-1 gene encodes an immunoreceptor tyrosine-based activation motif (ITAM) protein that may be evolutionarily conserved in diverse species by purifying selection. PMID: 21688146
  6. endocytosed BCR sequentially regulates MAPK and Akt signaling pathways from intracellular compartments PMID: 21964606
  7. Data indicate that both the Igalpha and the Igbeta cytoplasmic domains alone are sufficient for trafficking to lysosomal compartments, and are unaffected by mutation of 4 amino acid residues within their respective ITAMs. PMID: 20837062
  8. Arginine 198 in the tail of the Igalpha subunit of the BCR is methylated by the protein arginine methyltransferase 1. Methylation negatively regulates the calcium and PI-3 kinase pathways of the BCR, promoting signals leading to B cell differentiation. PMID: 20231378
  9. The direct recruitment of BLNK to immunoglobulin alpha couples the B-cell antigen receptor to distal signaling pathways PMID: 11909947
  10. IgA deficiency in lymphotoxin-deficient (LT(-/-)) mice could be fully reversed by reconstitution with LT-expressing bone marrow, despite the absence of both LNs and PPs. PMID: 12006975
  11. The VHDJH recombination process at the IgH locus and the survival of pro-B cells that carry these rearrangements do not depend on the expression of Ig-alpha molecules. PMID: 12097390
  12. Selective adherence of IgA to murine Peyer's patch M cells: evidence for a novel IgA receptor. PMID: 12165508
  13. Data show that expression of endogenous mb-1 transcripts correlates most closely with early-B-cell factor (EBF) expression and negatively with Id1, an inhibitor of E2A protein function, linking regulation of the mb-1 gene with EBF and E2A. PMID: 12446773
  14. Retrovirally expressed human Pax-5 protein activates endogenous early B-cell-specific mb-1 genes in mouse plasmacytoma cells, but only when the promoter is hypomethylated. PMID: 12612069
  15. Ig-alpha immunoreceptor tyrosine-based activation motif (ITAM) tyrosines (Y182 and Y193) are necessary for efficient pre-B cell differentiation. PMID: 17163454
  16. MHC II structural requirements for mediation of cell death signaling in a murine B cell lymphoma with Igalpha/beta PMID: 18194817

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Note=Following antigen binding, the BCR has been shown to translocate from detergent-soluble regions of the cell membrane to lipid rafts although signal transduction through the complex can also occur outside lipid rafts.
Tissue Specificity
B-cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1