Please click here to enter our new website >> Cusabio
 
 

 

Recombinant human ADP-ribosylation factor 4 protein
Product Name Recombinant human ADP-ribosylation factor 4 protein
Synonyms
Catalog Number CSB-RP009154h
Relevance GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
Mol. Weight 20 KD
Product Info GST tagged
Source E.coli derived
Purity 95%
Image
Storage Buffer 6M guanidine hydrochloride, 20mM Tris
Storage Store at -20, for extended storage, conserve at -20 or -80.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4 for up to one week.
AA sequence MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGG
QDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMT
DKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR-
Referrences [1] "Selective amplification of an mRNA and related pseudogene for a human ADP-ribosylation factor, a guanine nucleotide-dependent protein activator of cholera toxin."
Monaco L., Murtagh J.J. Jr., Newman K.B., Tsai S.-C., Moss J., Vaughan M.
Proc. Natl. Acad. Sci. U.S.A. 87:2206-2210(1990) [PubMed: 2107548] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA].

[2] "Human ADP-ribosylation factors. A functionally conserved family of GTP-binding proteins."
Kahn R.A., Kern F.G., Clark J., Gelmann E.P., Rulka C.
J. Biol. Chem. 266:2606-2614(1991) [PubMed: 1899243] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA].

[3] "Cloning and characterization of the human ADP-ribosylation factor 4 gene."
Lebeda R.A., Haun R.S.
Gene 237:209-214(1999) [PubMed: 10524252] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].

 

ELISA Kit
Other Kit

 

Native Protein
Recombinant Protein
In Stock
Order now, ship in 6 weeks

 

Immune Serum

 

Primary Antibodies
Monoclonal Antibodies
Polyclonal Antibodies
Secondary Antibodies

 

 

RT-PCR Primer
Clone

 

 

Diagnostic Antigen
Diagnostic Antibody

 

 

Home    |    About Us    |    Products    |    Technical Support    |    Distributor    |    Contact Us    |    Privacy Statement

Copyright © 2010 www.cusabio.com All Rights Reserved.