Please click here to enter our new website >> Cusabio
 
 

 

Recombinant human Ornithine decarboxylase protein
Product Name Recombinant human Ornithine decarboxylase protein
Synonyms
Catalog Number CSB-RP005354h
Relevance L-ornithine = putrescine + CO2.
Inhibited by S-nitrosylation
Mol. Weight 52 KD
Product Info GST tagged
Source E.coli derived
Purity 95%
Image
Storage Buffer 6M guanidine hydrochloride, 20mM Tris
Storage Store at -20, for extended storage, conserve at -20 or -80.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4 for up to one week.
AA sequence MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKC
NDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELM
KVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQ
AISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYV
ASAFTLAVNIIAKKIVLKEQTGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKY
YSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQF
QNPDFPPEVEEQDASTLPVSCAWESGMKRHRAACASASINV-
Referrences [1] "Complete amino acid sequence of human ornithine decarboxylase deduced from complementary DNA."
Hickok N.J., Seppaenen P.J., Gunsalus G.L., Jaenne O.A.
DNA 6:179-187(1987) [PubMed: 3595418] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA].

[2] Jaenne O.A.
Submitted (APR-2003) to the EMBL/GenBank/DDBJ databases
Cited for: SEQUENCE REVISION TO 415.

[3] "Characterization and sequence analysis of the human ornithine decarboxylase gene."
Fitzgerald M.C., Flanagan M.A.
DNA 8:623-634(1989) [PubMed: 2693021] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].

 

ELISA Kit
Other Kit

 

Native Protein
Recombinant Protein
In Stock
Order now, ship in 6 weeks

 

Immune Serum

 

Primary Antibodies
Monoclonal Antibodies
Polyclonal Antibodies
Secondary Antibodies

 

 

RT-PCR Primer
Clone

 

 

Diagnostic Antigen
Diagnostic Antibody

 

 

Home    |    About Us    |    Products    |    Technical Support    |    Distributor    |    Contact Us    |    Privacy Statement

Copyright © 2010 www.cusabio.com All Rights Reserved.