Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by the ability of Recombinant CCL3 to chemoattract human CCR5 transfected BaF3 mouse proB cells is typically 3-10 ng/mL.
Alternative Names
C C motif chemokine 3; CCL 3; CCL3; CCL3_HUMAN; Chemokine (C C motif) ligand 3; Chemokine C C motif ligand 3; Chemokine ligand 3; G0/G1 switch regulatory protein 19 1; G0/G1 switch regulatory protein 19-1; G0S19 1; G0S19 1 protein; Heparin binding chemotaxis protein; L2G25B ; LD78 alpha; LD78-alpha(4-69); LD78alpha; Macrophage inflammatory protein 1 alpha ; Macrophage inflammatory protein 1-alpha; macrophage inflammatory protein 1a; MIP 1 alpha; MIP 1A; MIP-1-alpha; MIP-1-alpha(4-69); MIP1 alpha; MIP1A; PAT 464.1; SCYA 3; SCYA3; SIS alpha; SIS beta; SIS-beta; Small inducible cytokine A3 ; small inducible cytokine A3 (homologous to mouse Mip-1a); Small-inducible cytokine A3; Tonsillar lymphocyte LD78 alpha protein
Species
Homo sapiens (Human)
Expression Region
24-92aa
Complete Sequence
SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Protein Length
Full Length of Mature Protein
Buffer
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The Recombinant Human CCL3 protein is an essential research tool for scientists focusing on immunology. This C-C motif chemokine 3, known by its aliases CCL3, G0S19-1, MIP1A, and SCYA3, is expressed in E. coli and spans the 24-92aa region, encompassing the full length of the mature protein. Provided as a tag-free, lyophilized powder, this protein can be easily reconstituted using sterile water or a suitable buffer to meet various experimental needs.
Our Recombinant Human CCL3 protein demonstrates a high purity of greater than 95%, as established by SDS-PAGE analysis. Endotoxin levels are stringently controlled, ensuring they remain below 1.0 EU/µg, as verified by the LAL method. The protein is fully biologically active, as demonstrated by its ED50 in the range of 3-10 ng/mL, determined by its ability to chemoattract human CCR5 transfected BaF3 mouse proB cells.