Recombinant Mouse Beta-nerve growth factor(Ngf) (Active)

In Stock
Code CSB-AP004101MO
Product Type Growth Factor
Size $91Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P01139
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Alias Beta-nerve growth factor; Beta-NGF; Ngf
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined in a cell proliferation assay using TF?1 human erythroleukemic cells is less than 2 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG
Research Area Neuroscience
Source E.coli
Gene Names Ngf
Expression Region 122-241aa
Tag Info Tag-Free
Mol. Weight 13.5 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI.
Subcellular Location Secreted
Protein Families NGF-beta family
Database Links

KEGG: mmu:18049

STRING: 10090.ENSMUSP00000102538

UniGene: Mm.1259

Pathway MAPK signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Ras signaling pathway
Rap1 signaling pathway
Inflammatory Pain
Inhibitors of axonal regeneration

Related Products

Ngf Proteins

Ngf Proteins for Mus musculus (Mouse)

Ngf ELISA Kit

Ngf ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.