Recombinant Human Interleukin-3(IL3),partial (Active) (GMP)


In Stock
GMP
Code CSB-AP005821HU
Product Type Interleukin
Size $3929Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P08700
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4, with 0.02 % Tween-20.
Alias Hematopoietic growth factor,Mast cell growth factor,MCGF,Multipotential colony-stimulating factor,P-cell-stimulating factor,IL-3
Species Homo sapiens (Human)
Biological_Activity Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 107 IU/mg.
Purity > 98 % by SDS-PAGE and HPLC analyses.
Endotoxin Less than 0.01 EU/μg of rHuIL-3 GMP as determined by LAL method.
Sequence APMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Research Area Immunology
Source E.Coli
Gene Names IL3
Expression Region 20-152aa
Tag Info Tag-Free
Mol. Weight 15.1 kDa
Protein Description Partial
PubMed ID 3497843; 3127463; 3489530; 15372022; 15489334; 2544122; 8676386
Still Have Questions? Leave a Message or Start an on-line Chat
Function Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; FUNCTION
Subcellular Location Secreted
Protein Families IL-3 family
Tissue Specificity Activated T-cells, mast cells, natural killer cells.
Database Links

HGNC: 6011

OMIM: 147740

KEGG: hsa:3562

STRING: 9606.ENSP00000296870

UniGene: Hs.694

Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Fc epsilon RI signaling pathway
Hematopoietic cell lineage

Related Products

IL3 Antibodies

IL3 Antibodies for Homo sapiens (Human)

IL3 Antibodies for Human

IL3 Proteins

IL3 Proteins for Homo sapiens (Human)

IL3 ELISA Kit

IL3 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.