Recombinant Human Interleukin-7(IL7)

In Stock
Code CSB-AP004441HU
Product Type Interleukin
Size US$195
Uniprot No. P13232
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 250 mM NaCl, pH 7.2
Alias Interleukin-7; IL-7; IL7
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is less than 0.4 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Research Area Immunology
Source E.coli
Gene Names IL7
Expression Region 26-177aa
Tag Info Tag-Free
Mol. Weight 17.5 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.
Subcellular Location Secreted
Protein Families IL-7/IL-9 family
Database Links

HGNC: 6023

OMIM: 146660

KEGG: hsa:3574

STRING: 9606.ENSP00000263851

UniGene: Hs.591873

Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Hematopoietic cell lineage

Related Products

IL7 Antibodies

IL7 Antibodies for Homo sapiens (Human)

IL7 Proteins

IL7 Proteins for Homo sapiens (Human)

IL7 ELISA Kit

IL7 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.