Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM5 at 2μg/mL can bind Anti-CEACAM5 recombinant antibody (CSB-RA005165MA1HU), the EC50 is 0.8955-1.719 ng/mL.
Alternative Names
(Carcinoembryonic antigen)(CEA)(Meconium antigen 100)(CD antigen CD66e)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
35-685aa(E398K)
Target Protein Sequence
KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Human CEACAM5 recombinant protein was produced in mammalian cell, where the gene sequence encoding Human CEACAM5 (expression area: 35-685aa; mutation site: E398K) was expressed with the C-terminal 10xHis tag. The purity of this CEACAM5 protein was greater than 95%. The activity was validated.
CEACAM5 (known as CEA, CD66e) belongs to the carcinoembryonic antigen CEACAM subfamily of the immunoglobulin superfamily. It is a homodimeric protein and cell surface glycoprotein that is overexpressed in many cancers and has been implicated in adhesion and invasion.
CEACAM5 is predominantly expressed by epithelial cells and is differentially expressed between species. In normal adult tissues, CEACAM5 is located in the stomach, tongue, esophagus, cervix, sweat glands and prostate. High CEACAM5 can be detected in tumor cells of advanced non-small cell lung cancer, small cell lung cancer, pancreatic cancer, gallbladder cancer, bladder cancer, mucinous ovarian cancer, endometrial cancer, colorectal cancer and gastric cancer.
CEACAM5 protein has a long history as a tumor biomarker. In 1965, researchers first discovered that CEA can be used as a marker of colorectal cancer, suggesting its significance in cancer research. The development of highly active and stable mammalian CEACAM5 protein will help to better study the mechanism and signaling pathway of CEACAM5 in the human body and help the research of related clinical drugs.