Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5) (E398K) (Active)

In Stock
Code CSB-MP005165HU
Abbreviation Recombinant Human CEACAM5 protein (E398K) (Active)
MSDS
Size $118
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM5 at 2μg/mL can bind Anti-CEACAM5 recombinant antibody (CSB-RA005165MA1HU), the EC50 is 0.8955-1.719 ng/mL.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM5 at 2μg/mL can bind Anti-CEACAM5 recombinant antibody (CSB-RA005165MA1HU), the EC50 is 0.8955-1.719 ng/mL.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
(Carcinoembryonic antigen)(CEA)(Meconium antigen 100)(CD antigen CD66e)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
35-685aa(E398K)
Target Protein Sequence
KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA
Mol. Weight
74.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Human CEACAM5 recombinant protein was produced in mammalian cell, where the gene sequence encoding Human CEACAM5 (expression area: 35-685aa; mutation site: E398K) was expressed with the C-terminal 10xHis tag. The purity of this CEACAM5 protein was greater than 95%. The activity was validated.

CEACAM5 (known as CEA, CD66e) belongs to the carcinoembryonic antigen CEACAM subfamily of the immunoglobulin superfamily. It is a homodimeric protein and cell surface glycoprotein that is overexpressed in many cancers and has been implicated in adhesion and invasion.
CEACAM5 is predominantly expressed by epithelial cells and is differentially expressed between species. In normal adult tissues, CEACAM5 is located in the stomach, tongue, esophagus, cervix, sweat glands and prostate. High CEACAM5 can be detected in tumor cells of advanced non-small cell lung cancer, small cell lung cancer, pancreatic cancer, gallbladder cancer, bladder cancer, mucinous ovarian cancer, endometrial cancer, colorectal cancer and gastric cancer.
CEACAM5 protein has a long history as a tumor biomarker. In 1965, researchers first discovered that CEA can be used as a marker of colorectal cancer, suggesting its significance in cancer research. The development of highly active and stable mammalian CEACAM5 protein will help to better study the mechanism and signaling pathway of CEACAM5 in the human body and help the research of related clinical drugs.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cell surface glycoprotein that plays a role in cell adhesion, intracellular signaling and tumor progression. Mediates homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. Plays a role as an oncogene by promoting tumor progression; induces resistance to anoikis of colorectal carcinoma cells.; (Microbial infection) Receptor for E.coli Dr adhesins. Binding of E.coli Dr adhesins leads to dissociation of the homodimer.
Gene References into Functions
  1. Positive CEA mRNA in low rectal cancer is a factor that predisposes patients to a high risk for overall recurrence, especially for local recurrence. PMID: 28291565
  2. High carcinoembryonic antigen elevation is associated with recurrence in rectal cancer. PMID: 29774483
  3. CEA and CA19-9 are cancer antigens that are late markers of carcinogenesis, with significantly elevated serum concentrations in case of colon cancer with already developed metastases. Older age group of patient has significantly elevated levels of both antigens. Cancer was twice more common in men than in women. PMID: 25568506
  4. High CEA expression is associated with breast cancer metastasis. PMID: 29433529
  5. Pretreatment serum CEA levels over 30.02 ng/mL on behalf of worse characteristics and unfavourable tumor behavior, and a poor prognosis for a nearly doubled risk of mortality in gastric cancer patients. PMID: 29358864
  6. Elevation of CEA level was an independent risk factor for the poor prognosis of early gastric cancer. PMID: 29121872
  7. The elevation of serum CEA level was independent from the other tumor markers in hypohidrotic condition represented by acquired idiopathic generalized anhidrosis. PMID: 28295553
  8. Elevated CEA levels during targeted therapy may be a more sensitive predictor of explosive lung adenocarcinoma progression in patients harboring mutant EGFRs compared to traditional imaging methods. PMID: 28705152
  9. Increased CEA expression is associated with colorectal cancer. PMID: 28128739
  10. The detection of TK1 combined with that of cytokeratin-19 fragment (CYFRA21-1), CEA or NSE increased the diagnostic value of TK1 for lung squamous cell carcinoma, adenocarcinoma and small cell lung cancer, respectively. PMID: 29247745
  11. In patients with non-small-cell lung cancer treated with nivolumab, worse pretreatment performance status, and higher carcinoembryonic antigen were associated with inferior progression-free survival. PMID: 29277824
  12. To examine the relation of carcinoembryonic antigen (CEA) response with tumor response and survival in patients with (K)RAS wild-type metastatic colorectal cancer receiving first-line chemotherapy in the FIRE-3 trial comparing FOLFIRI plus cetuximab versus FOLFIRI plus bevacizumab PMID: 27234640
  13. This is the first population-based investigation of a large cohort of exclusively stage I rectal cancer patients providing compelling evidence that elevated preoperative CEA level is a strong predictor of worse overall and cancer-specific survival. PMID: 27067235
  14. Elevated levels of systemic IFNgamma and IL-6 implied that the CEACAM5-specific T cells had undergone immune activation in vivo but only in patients receiving high-intensity pre-conditioning. PMID: 28660319
  15. Combination of the two tumor markers, CEA and CYFRA21-1, is a predictive and prognostic marker of docetaxel monotherapy for previously treated NSCLC patients PMID: 28870944
  16. Patients with CEA-High stage I NSCLC have a higher risk of regional or systemic relapse and should be followed-up carefully. PMID: 28870949
  17. Postoperative CEA level >2.5 ng/ml is a predictor of distant metastasis and a negative prognostic factor for survival in rectal cancer patients who receive preoperative chemoradiotherapy and curative surgery. PMID: 27553616
  18. Data show that triple-negative breast cancer (TNBC) patients with pre-therapeutic serum high levels of both carcinoembryonic antigen (CEA) and cancer antigen 15-3 (CA15-3) had shorter overall survival (OS) and disease-free survival (DFS) rates than those in the low-level groups. PMID: 27561099
  19. Serum CEA level is not influenced by the presence of benign dominant biliary stricture or superimposed bacterial cholangitis in patients with primary sclerosing cholangitis. PMID: 27943017
  20. Preoperative-CEA was elevated (>/=5.0 ng/mL) in 73.6% of the colorectal cancer patients and remained elevated after surgery in 32.7% of the patients. Elevated postoperative-CA 19-9 (>/=50 U/mL) was observed in 9.5% of the patients. Neither elevated pre-CEA nor elevated pre-CA 19-9 was associated with relapse-free survival (RFS) but both elevated post-CEA and elevated post-CA 19-9 were associated with reduced RFS. PMID: 27664887
  21. the diagnostic sensitivity and specificity of serum reactive oxygen species modulator 1 were only 41.38% and 86.21%, respectively, with the cutoff value of 27.22 ng/mL. The sensitivity and specificity of pleural fluid carcinoembryonic antigen were 69.23% and 88.00%, respectively, at the cutoff value of 3.05 ng/mL, while serum carcinoembryonic antigen were 80.77% and 72.00% at the cutoff value of 2.60 ng/mL. PMID: 28459208
  22. Taken together, the results of our study identified CEACAM5 as a novel cell surface binding target of Middle East respiratory syndrome coronavirus that facilitates infection by augmenting the attachment of the virus to the host cell surface. PMID: 27489282
  23. Data show that carcinoembryonic antigen (CEA) modestly differentiated between mucinous and nonmucinous lesions, and amylase did not distinguish intraductal papillary mucinous neoplasms (IPMNs) from mucinous cystadenomas (MCAs). PMID: 26646270
  24. In this study, we detected the tumor marker carcinoembryonic antigen (CEA) using the QD-LFTS system, which allowed quantitative analysis in the range of 1-100ng/mL with an ideal detection limit of 0.049ng/mL. Thus, the system is suitable for detecting CEA in the clinically accepted range. We also detected 70 positive and 30 negative serum samples using the Handing system, which exhibited good specificity and sensitivity. PMID: 27825889
  25. As a proof-of-concept study, the constructed platform exhibits good specificity for CEA and the detection limit reaches as low as 8pg/mL (45 fM) with a wide linear range from 0.01 to 60ng/mL in the both cases PMID: 27886601
  26. Under the optimal conditions, the proposed immunosensor was used for the detection of CEA with wide dynamic range in the range from 5 fg/mL to 50ng/mL with a low detection limit of 2fg/mL (S/N=3). PMID: 27871047
  27. Relative CL intensity of all-in-one dual-aptasensor, operated with the competitive reaction of CEA and hemin in the presence of the dual aptamer, was exponentially decreased with the increase of CEA concentration in human serum PMID: 27875751
  28. Data indicate that serum tumor markers showed significant shorter 3-year progression-free survival (PFS) in higher levels compared to lower levels for S-CYFRA 21-1 (cytokeratin 19 fragment), S-SCCA and S-CEA. PMID: 26432331
  29. Multivariate logistic regression analysis revealed TC and DeltaCEA as independent factors in predicting TRG; TC showed a sensitivity of 62.79 %, a specificity of 91.49 %, a Youden index of 0.543, a cutoff value of 5.52, and an AUC of 0.800 compared with DeltaCEA (sensitivity 76.74 %, specificity 65.96 %, Youden index 0.427, and AUC 0.761). PMID: 26531721
  30. Data suggest that joint detection of receptor-binding cancer antigen expressed on SiSo cells (RCAS1) and carcinoembryonic antigen (CEA) can improve the diagnostic sensitivity and specificity. PMID: 26438059
  31. High CEA level is associated with Oral Squamous Cell Carcinoma. PMID: 27165212
  32. High CEA expression is associated with metastasis and recurrence in endometrial cancer. PMID: 26779635
  33. ZKSCAN3 appears to promote colorectal tumor progression and invasion. ZKSCAN3 may facilitate hepatic metastasis of CRC associated with CEA particularly in cases with CEA-producing tumor PMID: 27127149
  34. we evaluated the clinical performance of LOCItrade mark-based tumor marker assays CEA, CA19-9, CA15-3, CA125 and AFP in patients with gastrointestinal cancer and demonstrated their high diagnostic power PMID: 28011514
  35. High carcinoembryonic Antigen expression is associated with gastric cancer. PMID: 25124614
  36. High CEA expression is associated with Squamous cell carcinoma of the skin. PMID: 27039776
  37. Preparation of Au-polydopamine functionalized carbon encapsulated FeO magnetic nanocomposites and their application for ultrasensitive detection of carcino-embryonic antigen. PMID: 26868035
  38. Elevated Carcinoembryonic Antigen Levels are associated with Colon Cancer. PMID: 26759308
  39. Baseline serum CEA levels can serve as predictive factors for the treatment of EGFR-TKI in non-small cell lung cancer patients harboring EGFR mutations. PMID: 27072247
  40. BALF and serum NSE, CEA, and CYFRA21.1 elevated in lung cancer, which had prompt value for pathology, especially significant for BALF. PMID: 27072263
  41. Significant levels of CEA, CYFRA 21-1, NSE, and TSGF were detected in the serum. The amounts found were useful for diagnosing non-small cell lung cancer (NSCLC) patients who depended on the currently limited biomarker development. PMID: 27072222
  42. We conclude that patients with high preoperative serum CEA levels should have more intensive follow-up for detection of synchronous liver metastasis. PMID: 26756614
  43. Elevated CEA expression is associated with Gastric Cancer. PMID: 26620645
  44. CEA, NSE, CA125 and pro-GRP could serve as biomarkers for SCLC, and CEA and CYFRA21-1 could serve as biomarkers for NSCLC. Pro-GRP, CA125 and CEA were related to the clinical stages of lung cancer PMID: 26560853
  45. In this phase I/II study, 14 high-risk disease-free ovarian (OC) and breast cancer (BC) patients after completion of standard therapies were vaccinated with MUC1, ErbB2 and carcinoembryonic antigen (CEA) HLA-A2+-restricted peptides and Montanide. PMID: 26892612
  46. combined pre-chemoradiotherapy CEA and post-chemoradiotherapy CEA levels enable more accurate prediction of rectal adenocarcinoma prognosis PMID: 26962798
  47. ESCC patients with lower Cyfra21-1 and CEA, higher miR-7 and severe myelosuppression were much more sensitive to CRT. PMID: 26708917
  48. Cyst fluid CEA levels have a clinically suboptimal accuracy level in differentiating pancreatic mucinous cystic neoplasms from pancreatic nonmucinous cystic neoplasms. PMID: 26077458
  49. High carcinoembryonic antigen expression is associated with Colon Adenomas. PMID: 27100181
  50. Serum CYFRA21-1 and CEA can be used as prognostic factors of NSCLC patients. Combinative detection of the two indices will be more reliable. PMID: 26333429

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Apical cell membrane. Cell surface.
Protein Families
Immunoglobulin superfamily, CEA family
Tissue Specificity
Expressed in columnar epithelial and goblet cells of the colon (at protein level). Found in adenocarcinomas of endodermally derived digestive system epithelium and fetal colon.
Database Links

HGNC: 1817

OMIM: 114890

KEGG: hsa:1048

STRING: 9606.ENSP00000221992

UniGene: Hs.709196

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*