Recombinant Human Claudin-4 (CLDN4)

In Stock
Code CSB-CF005506HU
Abbreviation Recombinant Human CLDN4 protein
MSDS
Size $1040
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Clostridium perfringens enterotoxin receptor;CPE-R;CPE-receptor;Williams-Beuren syndrome chromosomal region 8 protein
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-209aa
Target Protein Sequence
MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.1 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The Recombinant Human Claudin-4 (CLDN4) protein is a high-quality, full-length reagent specifically designed for cancer research. With a purity exceeding 90% as verified by SDS-PAGE, it ensures reliable and reproducible results in demanding applications. The CLDN4 protein is expressed as the nearly full-length sequence (amino acids 1-209) in an in vitro E. coli system and features an N-terminal 10xHis tag, facilitating straightforward purification and detection. Its identity is confirmed by Western Blot analysis, which shows a specific band at the expected molecular weight. Available in stock with flexible sizing options, this recombinant CLDN4 protein offers researchers a robust and accessible tool for investigating CLDN4's function as a Clostridium perfringens enterotoxin receptor and its implications in cancer biology.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Channel-forming tight junction protein that mediates paracellular chloride transport in the kidney. Plays a critical role in the paracellular reabsorption of filtered chloride in the kidney collecting ducts. Claudins play a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Gene References into Functions
  1. Claudin-4 expression can be absent or very focal in a subset of high-grade endometrial carcinomas PMID: 29671892
  2. these results suggest that Helicobacter pylori lipopolysaccharide induces TLR2 expression in the gastric adenocarcinoma cells, and that the longer the exposure to lipopolysaccharide, the greater the expression of TLR2 in the cell membrane; consequently the expression of claudin-4, -6, -7 and -9 also increases PMID: 29031421
  3. HIF-1alpha expression was upregulated in the vasculogenic mimicry-positive CRC cell line HCT-116 and thereby affected the expression of the EMT-related markers Claudin-4, E-cadherin (E-cd) and Vimentin(VIM). PMID: 27869227
  4. expression of claudin-4 is highly specific for true epithelial differentiation and may be useful to distinguish SWI/SNF complex-deficient undifferentiated carcinomas from sarcomas with epithelioid morphology. The lack of claudin-4 expression in ovarian small cell carcinomas of hypercalcemic type suggests that these tumors may be better regarded as sarcomas rather than carcinomas. PMID: 28084340
  5. Data indiate a regulatory network in gastric cancer whereby claudin-4 expression is reduced by specific miRNAs, which are in turn bound by specific lncRNAs acting as competing endogenous RNAs (ceRNAs), resulting in increased claudin-4 expression. PMID: 28819095
  6. This is the first study to show how TGF-beta regulates the expression of Claudin-4 through c-Jun signaling and how this pathway contributes to the migratory and tumorigenic phenotype of lung tumor cells. PMID: 27424491
  7. Claudin-4 functionally contributes to both ovarian tumor cell apoptosis resistance and migration and targeting extracellular loop interactions of claudin-4 may have therapeutic implications for reducing ovarian tumor burden. PMID: 27724921
  8. Fluorescence-based flow cytometry and xenon magnetic resonance imaging (MRI) indicate binding of the biosensor specifically to claudin 4 (Cldn4)-expressing cells. PMID: 28636798
  9. Studies indicate that Grainyhead-like transcription factor 2 (GRHL2) controls the expression of E-cadherin (CDH1) required for adherens junctions and possibly regulates the expression of claudin-4 (CLDN4) in tight junctions. PMID: 28636799
  10. Studies indicate claudin 1 (CLDN-1) as a target for improving epidermal drug absorption and preventing HCV infection and of claudin 4 (CLDN-4) as a target for anticancer therapeutics. PMID: 28415141
  11. Mislocalization claudin-3 to nucleus in colon cancer and mislocalization claudin-4 to nucleus in adenomas of the colon were detected for the first time. The potential reasons for the paradoxical expression are discussed and a review of the literature, related all the alleged mechanisms of this mislocalization is provided. PMID: 28295005
  12. Reg I may play a role in the maintenance of mucosal barrier function by inducing tight junction proteins such as claudins 3 and 4. PMID: 27055226
  13. claudin-4 may represent different mechanisms of lymphatic vessel invasion with both biomarkers is related to poor prognosis PMID: 26464161
  14. These results suggested that increase of Cldn4-expression may be involved in early molecular events during carcinogenesis of adenocarcinoma, whereas increase of Cldn7-expression may be associated with tumor invasion or progression. PMID: 26872891
  15. that claudins-4 and -7 might be valuable markers for distinguishing hepatocellular carcinoma and cholangiocarcinoma and that cholangiolocellular carcinoma might arise from hepatic ductal cells PMID: 27444172
  16. that claudin-4 can be helpful at least in making a reliable differential diagnosis of spiradenoma when overlapping morphologic features do not allow to further subclassification in the overwhelming variety of the adnexal tumors. PMID: 26616722
  17. Results showed overexpression of CLDN4 in endometrial cancer cells. Its intracellular presence coupled with the biphasic effects of E2 on its expression in the cytoskeleton suggest that it may be involved in cell signaling to and from tight junctions. PMID: 26043767
  18. claudin 1 and claudin 4 are differentially involved in atopic dermatitis pathogenesis PMID: 26319240
  19. Results suggested that claudin-4, which was regulated by methylation status, plays an important role in breast cancer growth and malignancy via the control of cell proliferation, migration and apoptosis. PMID: 26058359
  20. Overexpression of claudin-4 induced formation of vascular channels in breast cancer. PMID: 25871476
  21. This meta-analysis shows that over-expression of claudin-4 is associated with progress of gastric cancer and poor prognosis of gastric cancer patients. PMID: 26109060
  22. Data suggest that changes in DNA methylation in trophoblasts regulate (1) cell mobility/placentation, (2) expression of claudin-4 (CLDN4) and 4-fucosyltransferase (FUT4), and (3) matrix metalloproteinase (MMP2 and MMP9) activity. PMID: 25697377
  23. Data show that claudin-4 and claudin-7 were observed in hepatocytes of severely damaged mouse and human livers. PMID: 24737165
  24. increased claudin-3 and claudin-4 expression may play a postive role in the progression and metastasis of gastric cancer PMID: 25755790
  25. Studies suggest that claudin-3 and claudin-4 might be targets for the treatment of chemotherapy-resistant ovarian cancer and other tumors overexpressing claudin-3 and -4 using Clostridium perfringens enterotoxin (CPE)-based theranostic agents. PMID: 23685873
  26. Claudin-4 controls the receptor tyrosine kinase EphA2 pro-oncogenic switch through beta-catenin PMID: 25344320
  27. Our results indicate that CLDN4 expression is correlated with poor prognosis, and CLDN1 expression may be an indicator of recurrence of oral squamous cell carcinoma. PMID: 25964581
  28. Claudin-4 is frequently expressed in primary breast cancers but especially in their metastases and is thereby an attractive membrane bound molecular imaging and drug target. PMID: 25417118
  29. Claudins 2 and 4 have reciprocal effects on epithelial barrier function, exhibit differential FRAP dynamics, and compete for residency within the tight junction. PMID: 25031428
  30. Increased claudin 4 expression was related to advanced stage and decreased survival in nasopharyngeal carcinoma. PMID: 25778318
  31. Claudin 1, 4, and 7 are important building blocks of paracellular adhesion molecules; their decreased expression in colorectal cancer seems to have critical effects on cell proliferation, motility, invasion, and immune response against the tumor. PMID: 25038829
  32. upregulation of claudin-4 expression regulated by DeltaNp63 might be associated with complementary or repair responses of damaged keratinocytes with atopic dermatitis PMID: 25449274
  33. The present study demonstrates that high expression of claudins 1, 4, 5 and down-regulation of claudin-7 are positive prognostic markers and are associated with good outcome and increased survival rates. PMID: 24815833
  34. Low expression of claudin-4 is associated with recurrence in esophageal squamous cell carcinoma. PMID: 24737010
  35. The degradation of claudin-3 and claudin-4 induced by acidic stress could be attenuated by specific TRPV1 blockers. PMID: 24073800
  36. twist and zeb1 are involved in placental maturation, whereas claudin 4 appears to be connected with placental diseases such as diabetes, toxaemia or molar disease. PMID: 24304426
  37. Claudin-4 immunohistochemistry effectively distinguishes adenocarcinoma from malignant mesothelioma with high sensitivity and specificity in the evaluation of malignant effusions. PMID: 24421209
  38. Claudin-4 was very useful marker for distinguishing mesothelioma and adenocarcinoma PMID: 23775021
  39. claudin-4 and PAX8 have a higher sensitivity and specificity for discriminating between pleural epithelioid mesotheliomas and renal cell carcinomas compared with other positive carcinoma markers PMID: 23503645
  40. High claudin-4 expression is associated with gastric carcinoma. PMID: 23822740
  41. PAX8 and claudin-4 have a higher sensitivity and specificity for assisting in discriminating between peritoneal epithelioid mesotheliomas and serous carcinomas when compared with all of the other positive carcinoma markers PMID: 23196794
  42. Exceedingly high levels of CLDN4 might negatively influence fertility rates. PMID: 23668053
  43. Knockdown of claudin-4 inhibited cell motility and the mimic peptide had no effect on motility in the claudin-4 knockdown cells. PMID: 23521713
  44. Claudin-4 is a highly specific and sensitive immunohistochemical marker for assisting in distinguishing epithelioid mesotheliomas from metastatic carcinomas to the serosal membranes. PMID: 23596113
  45. Altered claudin-4 expression in progesterone-treated endometrial adenocarcinoma cell line Ishikawa. PMID: 23095775
  46. Claudin-3(CLDN3) and claudin-4 (CLDN4) affect sensitivity of the ovarian cancer cells to the cytotoxic effect of cisplatin by regulating expression of the Cu transporter CTR1. PMID: 23053666
  47. Modeling the "airway reopening" process, examined consequent increases in pulmonary epithelial plasma membrane rupture, paracellular permeability, and disruption of the tight junction proteins zonula occludens-1 and claudin-4. PMID: 22898551
  48. High CLDN4 expression is associated with tumor growth and metastases. PMID: 23097631
  49. Progesterone could inhibit the growth of Ishikawa cells by decreasing the expression of claudin-4. PMID: 22883527
  50. these results indicate that Twist1 induces the repression of claudin-4 expression during the epithelial-mesenchymal transition in esophageal carcinoma. PMID: 22668877

Show More

Hide All

Involvement in disease
CLDN4 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.
Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Protein Families
Claudin family
Database Links

HGNC: 2046

OMIM: 602909

KEGG: hsa:1364

STRING: 9606.ENSP00000342445

UniGene: Hs.647036

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*