Recombinant Human Insulin (INS), partial

In Stock
Code CSB-YP011742HU-WD
Abbreviation Recombinant Human Insulin protein, partial
MSDS
Size $226
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
≤20 EU/mg by the LAL method
Target Names
Insulin
Uniprot No.
Alternative Names
Insulin; INS; IDDM; ILPR; IRDN; MODY10
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
25-54aa&90-110aa
Target Protein Sequence
GIVEQCCTSICSLYQLENYCN&FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Mol. Weight
5.8kd
Protein Length
Partial
Tag Info
Tag free
Form
Lyophilized
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered solution(It is recommended to redissolve in sterile 0.01 M HCl at a concentration of not less than 1mg/mL.)
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. It is recommended to redissolve in sterile 0.01 M HCl at a concentration of not less than 1mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Gene References into Functions
  1. genetic association studies in population of children in Japan: Data suggest that mutations in INS, HNF1A, HNF4A, and HNF1B likely play critical roles in children with insulin-requiring autoantibody-negative type 1 diabetes in the population studied. (INS = insulin; HNF1A = HNF1 homeobox A; HNF4A = hepatocyte nuclear factor 4 alpha; HNF1B = HNF1 homeobox B) PMID: 28597946
  2. Insulin signaling pathway protects neuronal cell lines by Sirt3 mediated IRS2 activation. PMID: 29411439
  3. Insulin promotes progression of colon cancer by upregulation of ACAT1. PMID: 29793481
  4. Data suggest that serum leptin and insulin levels are associated with retinal microvasculature parameters in healthy children and adolescents; higher cardiometabolic risk factors (high serum leptin, insulin, and insulin resistance) correlate with wider retinal arterioles. PMID: 29303782
  5. Data, including studies involving single-cell analysis, suggest that insulin-secreting cells exhibit 3 major states regarding unfolded protein response (UPR): (1) low UPR and low insulin gene expression; (2) low UPR and high insulin gene expression; (3) high UPR and low insulin gene expression. The latter state promotes cell proliferation; UPR appears to mediate recovery from ER stress due to high insulin production. PMID: 29950394
  6. Data confirm that cord blood levels of ghrelin, leptin, and insulin of term newborns correlate with anthropometric parameters at birth (birth weight, head circumference, etc.). PMID: 29320365
  7. Glucose-dependent de-SUMOylation of tomosyn1 at K298 releases syntaxin1A and controls the amplification of exocytosis in concert with a recently-identified tomosyn1-interacting partner; the Ca(2+)-binding protein secretagogin, which dissociates from tomosyn1 in response to Ca(2+)-raising stimuli and is required for insulin granule trafficking and exocytosis downstream of Ca(2+) influx. PMID: 28325894
  8. results indicate that higher cerebrospinal fluid insulin levels are related to impairment in cognitive performance and biomarkers of Alzheimer's disease among women and non-carriers of the APOE varepsilon4 allele PMID: 29154275
  9. single-particle cryo-electron microscopy reconstructions of the 1:2 (4.3 A) and 1:1 (7.4 A) complexes of the insulin receptor ECD dimer with insulin PMID: 29512653
  10. Data suggest that higher plasma levels of ceramide with saturated fatty acid are associated with higher fasting levels of insulin and insulin resistance; in contrast, higher levels of sphingomyelin with saturated fatty acid are associated with lower fasting insulin and insulin resistance; this study was conduced in American Indians in AZ, OK, SD, and ND. PMID: 29588286
  11. in latent autoimmune diabetes in adults, higher leptin secretion may exert a direct effect on beta cell function leading to more insulin sensitivity PMID: 29252126
  12. Identify a novel proinsulin-associated locus and demonstrate that whilst proinsulin levels are associated with carotid intima media thickness measures, proinsulin per se is unlikely to have a causative effect on cIMT. PMID: 29040868
  13. Data suggest that positive association exists between up-regulated serum C-peptide levels and risks of pre-diabetes and diabetes type 2 among Chinese women with prior gestational diabetes. PMID: 28919328
  14. Data suggest that both a KATP channel-dependent triggering pathway (that induces a [Ca2+]i rise in beta-cells) and an amplifying pathway (that augments the effect of Ca2+ on exocytosis) are crucial for control of insulin secretion in human islets; these studies used cultured pancreatic islets from multiorgan donors exposed to a variety of pharmacological agents. PMID: 28116849
  15. In the present study, the protein inhibitor of activated STAT Y (PIASy) was identified as a novel Isl1-interacting protein. Furthermore, PIASy and Isl1 upregulate insulin gene expression and insulin secretion in a dose-dependent manner by activating the insulin promoter. PMID: 28000708
  16. Muscle-related indices positively correlated with C-peptide, which showed endogenous insulin reserve PMID: 29132475
  17. Data suggest that corticosterone and cortisol suppress voltage-dependent Ca2+ channel function and Ca2+ fluxes in beta-cells; however, insulin secretion, maximal ATP/ADP responses to glucose, and beta-cell identity/differentiation are all unaffected by these glucocorticoids. PMID: 29203512
  18. In long-standing models, glucose is viewed as a primary stimulator of insulin secretion; recent models postulate that glucose activates a cell-surface receptor, namely the glucose-sensing receptor, on insulin-secreting cells. [REVIEW] PMID: 28880472
  19. Data suggest that beta-cell insulin secretory granules, unlike neuronal synaptic vesicles, exhibit biphasic secretory mechanism that requires additional distinct features in exocytosis; beta-cell insulin exocytotic events appear to be mediated by Munc18/SNARE protein complexes distinct from those involved in predocking/fusion of insulin secretory granules with plasma membrane. [REVIEW] PMID: 28880475
  20. Data suggest that glucose-stimulated insulin secretion involves interplay between metabolic and cationic events involving small G-proteins; activation of these signaling proteins promotes cytoskeletal remodeling, transport and docking of insulin granules on the plasma membrane for exocytotic secretion of insulin. [REVIEW] PMID: 28880478
  21. Data suggest that insulin secretory granule turnover consists of several highly regulated processes allowing for proper beta-cell function and insulin secretion. [REVIEW] PMID: 28880479
  22. Data suggest that cAMP acts as amplifier of insulin secretion triggered by Ca2+ elevation in beta-cells; both messengers are also positive modulators of glucagon release from alpha-cells, but in this case cAMP signaling may be the important regulator and Ca2+ signaling has a more permissive role. [REVIEW] PMID: 28466587
  23. These data implicate the existence of beta cells enriched for inefficient insulin/C-peptide production in type 1 diabetes patients, potentially less susceptible to autoimmune destruction. PMID: 28877460
  24. Serum C-peptide levels were strongly associated with increased serum TG and reduced HDL-C levels in the elderly.Our results suggest that serum C-peptide increases the risk of CVD via a pathway that increases TG or decreases HDL-C levels. PMID: 28869884
  25. Proinsulin is involved in regulating the growth and differentiation of hematopoietic stem cells. PMID: 28758130
  26. This article reviews the roles of CFTR in epithelial cells, its regulatory role in insulin secretion, and a mechanism of CFTR regulation by insulin. [review] PMID: 28805732
  27. During HCV infection, adiponectin affects insulin sensitivity through triglycerides and after viral clearance, adiponectin levels were directly associated with insulin sensitivity and decreased upon improved hepatic fibrosis. PMID: 28267407
  28. Data suggest that, in type 2 diabetes, the reduction in insulin secretion by pancreatic beta-cells can be considered, at least in part, to result from an imbalance of beta-cell renewal and apoptosis. [REVIEW] PMID: 28242267
  29. the severity of metabolic syndrome exhibits long-term links to levels of insulin and adiponectin, suggesting potential genetic and environmental influences on insulin resistance over time PMID: 27133621
  30. Data suggest that secretion of insulin by beta-cells is related to insulin resistance in complex manner; insulin secretion is associated with type 2 diabetes in obese and non-obese subjects, but insulin resistance is associated with type 2 diabetes only in non-obese subjects. Chinese subjects were used in these studies. PMID: 27012460
  31. Results suggest that optimised lentiviral transduction of the insulin gene into primary canine mesenchymal stromal cells (cMSCs) renders these cells capable of secreting insulin over both the short- and long-term, in sufficient quantities in vitro to support their potential use in insulin gene therapy. PMID: 27572655
  32. C-peptide-based measurements of insulin secretion are appropriate for assessing beta-cell function in SGLT2 inhibitor canagliflozin-treated participants. PMID: 27127999
  33. Many studies provided evidence that circulating unmethylated INS DNA can be a potential noninvasive biomarker of beta cell mass loss in type 1 Diabetes. [review] PMID: 28450972
  34. Upon stratifying the participants into tertiles by the Matsuda index, we observed an inhibitory relationship between the genetic risk score (GRS) and insulin secretion in low insulin sensitive but not in high insulin sensitive controls and treatment-naive Type 2 diabetes. PMID: 27280334
  35. Family income at birth, non-white maternal skin color, and rapid weight gain between two and four years of age were associated with high levels of C-peptide. PMID: 28693499
  36. The possibility of using insulin as a biomarker to guide insulin-targeted interventions also should be taken into account PMID: 27388232
  37. the concentrations of insulin, IGF-1, IGFBP-3 and their association with prostate size in patients with BPH PMID: 28300542
  38. C-peptide was associated with cardiovascular mortality independently of known diabetes status in a cohort of patients with chronic atherosclerotic disease. PMID: 28565926
  39. Elevated Unmethylated Insulin DNA Is associated with beta cell death. PMID: 27643615
  40. These results provide new information on the role of human islet-derived extracellular vesicles in the regulation of insulin expression in differentiating induced pluripotent stem cell clusters. PMID: 29117231
  41. our experiments reveal an insulin-dependent activation of MCH neurons in obesity, which contributes via distinct mechanisms to the manifestation of impaired locomotor activity and insulin resistance. PMID: 27926856
  42. These data support a role for islet NGF in fine-tuning insulin secretion. PMID: 27424144
  43. Data suggest early peaks in glucagon-like peptide-1 and glucagon secretion/blood level together trigger exaggerated insulinotropic response (high insulin secretion/level) to eating and consequent hypoglycaemia in patients with postprandial hypoglycaemia as a postoperative complication following Roux-en-Y gastric bypass for obesity complicated by type 2 diabetes; this retrospective cohort study was conducted in London. PMID: 28855269
  44. Studies on the susceptibility to aggregation of truncated analogs of insulin amyloidogenic core show three groups of peptides. Truncation of A13-A419 fragment shows that fibrous structures are formed by all peptides bearing (13)H-LeuTyr-OH(14). Propensity to aggregation was found for (16)H-TyrLeu-OH(17) B12-B17 fragment. PMID: 27463367
  45. Insulin and PI3K/AKT signaling are essential for RNase 7 expression and increased infection risks in diabetic patients may be secondary to suppressed RNase 7 production. PMID: 27401534
  46. A common variant, i.e., single nucleotide polymorphism rs6741949, in the DPP4 gene interacts with body adiposity and negatively affects glucose-stimulated GLP-1 levels, insulin secretion, and glucose tolerance. PMID: 28750074
  47. Insulin secretion by pancreatic beta-cells increases after adrenalectomy for aldosterone-producing adenomas; adrenalectomy in these patients prevents primary aldosteronism; such data suggest that aldosterone excess inhibits insulin secretion by pancreatic beta-cells. This retrospective study was conducted in Japan. PMID: 28111382
  48. Results indicate that insulin scores, but not glycemic scores, were positively associated with colorectal cancer (CRC) mortality. PMID: 28268248
  49. Data suggest that higher dietary intake of glucose, but not of fructose or of sucrose, is associated with insulin resistance; no associations were observed for high dietary intakes of glucose, fructose, or sucrose with loss of function of pancreatic beta-cells in secretion of insulin. This study was conducted in the Netherlands among patients newly diagnosed with prediabetes or type 2 diabetes. PMID: 28406435
  50. Higher maternal total n-3 PUFAs and specifically DHA levels during pregnancy are associated with higher childhood total-cholesterol, HDL-cholesterol and insulin levels. PMID: 27919543

Show More

Hide All

Involvement in disease
Hyperproinsulinemia (HPRI); Diabetes mellitus, insulin-dependent, 2 (IDDM2); Diabetes mellitus, permanent neonatal (PNDM); Maturity-onset diabetes of the young 10 (MODY10)
Subcellular Location
Secreted.
Protein Families
Insulin family
Database Links

HGNC: 6081

OMIM: 125852

KEGG: hsa:3630

STRING: 9606.ENSP00000250971

UniGene: Hs.272259

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*