Recombinant Human Interleukin-10 (IL10) (Active)

In Stock
Code CSB-MP011580HU
Abbreviation Recombinant Human IL10 protein (Active)
MSDS
Size $190
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human IL10RA (CSB-MP621688HU(A4)) at 2 μg/ml can bind Human IL10. The EC50 is 20.12-23.59 ng/mL. The VLPs (CSB-MP3838) is negative control. Biological Activity Assay
  • Activity
    Human IL10 captured on Protein A Chip can bind Recombinant Human IL10RA (CSB-MP621688HU(A4)) with an affinity constant of 85.8 pM as detected by MetaSPR Assay (WeSPRTM 200). Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human IL10RA (CSB-MP621688HU(A4)) at 2 μg/mL can bind Human IL10. The EC50 is 20.12-23.59 ng/mL. The VLPs (CSB-MP3838) is negative control.
②Human IL10 captured on Protein A Chip can bind Recombinant Human IL10RA (CSB-MP621688HU(A4)) with an affinity constant of 85.8 pM as detected by MetaSPR Assay (WeSPRTM 200).
Target Names
Uniprot No.
Alternative Names
Interleukin-10; IL-10; Cytokine synthesis inhibitory factor; CSIF
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
19-178aa
Target Protein Sequence
SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Mol. Weight
47.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc1-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Major immune regulatory cytokine that acts on many cells of the immune system where it has profound anti-inflammatory functions, limiting excessive tissue disruption caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptor comprising IL10RA and IL10RB leading to JAK1 and STAT2-mediated phosphorylation of STAT3. In turn, STAT3 translocates to the nucleus where it drives expression of anti-inflammatory mediators. Targets antigen-presenting cells (APCs) such as macrophages and monocytes and inhibits their release of pro-inflammatory cytokines including granulocyte-macrophage colony-stimulating factor /GM-CSF, granulocyte colony-stimulating factor/G-CSF, IL-1 alpha, IL-1 beta, IL-6, IL-8 and TNF-alpha. Interferes also with antigen presentation by reducing the expression of MHC-class II and co-stimulatory molecules, thereby inhibiting their ability to induce T cell activation. In addition, controls the inflammatory response of macrophages by reprogramming essential metabolic pathways including mTOR signaling.
Gene References into Functions
  1. Autocrine IL10 regulates Op18/stathmin signaling via an IL10NFkappaBERK/CDC2 axis. PMID: 30320402
  2. CD163(+)CD204(+) Tumor-associated macrophages possibly play a key role in the invasion and metastasis of oral squamous cell carcinoma by T-cell regulation via IL-10 and PD-L1 production. PMID: 28496107
  3. study showed that the rs1800872 A allele of the IL-10 gene may contribute to the genetic susceptibility of Behcet's disease by regulating the expression of IL-10. PMID: 29294320
  4. study indicates that anti-inflammatory macrophage function and mucosal immune tolerance require both WASP and DOCK8, and that IL-10 signalling modulates a WASP-DOCK8 complex PMID: 29725003
  5. This study demonstrated the alteration of IL-10 levels in aseptic non-vasculitic cerebral sinovenous thrombosis PMID: 30246697
  6. The interleukin-10 gene promoter rs1800872 single nucleotide polymorphism is associated with predisposition to chronic hepatitis C in case of infection with hepatitis C virus 1b genotype in the Russian population. PMID: 29247709
  7. Mycobacterium tuberculosis infection disturbs the HDAC6/HDAC11 levels to induce IL-10 expression in macrophages. PMID: 29523311
  8. The results of this meta-analysis indicated that there is no association between the IL-10 -592 A/C promoter polymorphism and gastrointestinal tract cancer susceptibility. PMID: 29720026
  9. Low IL10 expression is associated with dyslipidaemia, high blood pressure and glucose intolerance. PMID: 29615317
  10. Regulatory polymorphism in the IL-10 gene promoter has a possible and significant association with severity and outcome in patients with acute viral hepatitis, and acute liver failure PMID: 30109600
  11. These results demonstrate that monocyte derived IL-10 acts to inhibit potentially protective cell mediated immune responses against B. pseudomallei, but may also moderate the pathological effects of excessive cytokine production during sepsis. PMID: 28216665
  12. Individuals with posttraumatic stress disorder showed a significant increase in the serum levels of IL-10 (and IL-6). PMID: 29179015
  13. IL-10 SNP at -819 was associated with enhanced AML risk, suggesting that rs1800871 provides clue for future studies and early detection of Acute myeloid leukemia . PMID: 30197353
  14. Although IL-10 promoter polymorphisms are not associated with P. falciparum and S. haematobium co-infection, variant -1082G/A and haplotype GCC are associated with malaria, whereas the IL-10 haplotypes GCC and GTA are associated with schistosomiasis. PMID: 29131459
  15. high IL-10 in rheumatoid arthritis is associated with increased depressive symptoms PMID: 30148175
  16. besides the NF-kappaB pathway, the mechanism of action of FGF-21 was observed to involve the elevation of IL-10 in the ERK1/2 pathway. PMID: 29427162
  17. meta-analysis strongly suggests that the IL10 rs1800896, rs1800871, and rs1800872 polymorphisms are not associated with the risk of autoimmune liver disease PMID: 29694797
  18. Single nucleotide polymorphisms (SNPs) rs12979860 and rs8099917 (IL28B) and rs1800896, rs1800871, and rs1800872 (IL10) are related to treatment outcome, but previous studies clustered nonresponse and relapse patients.Frequency of rs12979860 and rs8099917 is different between relapsers and nonresponders, but similar between relapsers and responders PMID: 29888255
  19. The aim of this study was to explore the possible correlations of serum interleukins and soluble ST2 (sST2) protein with clinical features and inflammatory cytokines in rheumatoid arthritis (RA) patients. PMID: 29798971
  20. Anti-inflammatory cytokines, IL-10 and TGF-beta1, are not upregulated in the serum of patients with juvenile idiopathic arthritis. PMID: 29494710
  21. Overall, no significant association between IL-10 -592 A/C polymorphism and Kawasaki disease risk was found under allele contrast. The IL-10 -592 A/C polymorphism was not associated with Kawasaki disease risk in the Chinese population. PMID: 29656715
  22. These results suggest that the IL-10 -1082 G/A polymorphism confers susceptibility to juvenile idiopathic arthritis. PMID: 29748155
  23. Data show that multiple sclerosis TH1/17 cells have reduced expression of interleukin 10 (IL10) compared to healthy controls. PMID: 29150604
  24. High IL10 and Tumor necrosis factor-alpha expression is associated with coronary artery disease. PMID: 28988596
  25. Results discovered that plasma IL-10 levels in acute respiratory distress syndrome patients were correlated with severity of illness during extracorporeal membrane oxygenation institution. Also, high interleukin-10 was found to be associated to two polymorphic nucleotides at the gene promoter area. PMID: 28432351
  26. association of gene polymorphism (-819C > T, -592C > A and -1082G > A) with preterm birth PMID: 29147889
  27. Suggest that the IL-10 -819T/T variant and the ATA haplotype, which are associated with low production of IL 10, represent genetic risk factors for preeclampsia in Tunisian women. PMID: 29523264
  28. The IL-10 rs1800890 variant might contribute to RA susceptibility in the Chinese population. PMID: 29487192
  29. findings support the hypothesis that the -1082A>G polymorphism in the IL10 gene might be associated with diabetic kidney disease in white Brazilians with type 2 diabetes. PMID: 29227971
  30. This study showed that the activated FcgammaRII(low/-) B cells from HCC tumours, but not the resting FcgammaRII(high) B cells, without external stimulation suppress autologous tumour-specific cytotoxic T-cell immunity via IL-10 signals. PMID: 27853178
  31. It was shown that the expression of CD274, Il-10, and FOXP3 was closely correlated with the clinical characteristics of laryngeal squamous cell carcinoma, including lymph node metastasis and prognosis. PMID: 29257349
  32. IL-10 mRNA levels in peripheral B cells were significantly higher in lung cancer patients.A negative correlation was identified between miR-98 and IL-10 in peripheral B cells. PMID: 27605397
  33. These findings added to the accumulating evidence that promoter haplotypes of IL-10 may be important modulators of the development of amnestic mild cognitive impairment PMID: 29201645
  34. Findings suggest that the combinatorial complexity of TNFA and IL10 promoter polymorphisms impacts systemic lupus erythematosus susceptibility. PMID: 29298134
  35. The combination of IL10 and DAO SNPs in a multivariate model did not alter the OR values. PMID: 28750137
  36. The results indicate that IL10-1082 A/G polymorphism is associated with genetic susceptibility/predisposition to Rheumatoid arthritis in North Indian population. PMID: 29621504
  37. IL-33 increased IL-10 expression in MFCs via activating ERK 1/2 and STAT3, which subsequently promoted IL-10 transcription and thus contributed to the beneficial effects of IL-33 on MFCs. PMID: 29099095
  38. theses results suggest that IL-10 genotypes of recipient are the most associated with the risk of complications after haematopoietic stem cell transplantation PMID: 28987962
  39. Our results suggest that genetic variation in IL-10 gene is unlikely to confer susceptibility to Henoch-Schonlein purpura in Chinese children. PMID: 28963667
  40. neither allele nor genotype frequencies of IL-10 polymorphisms were associated with inflammatory bowel disease in Iranian patients PMID: 28872970
  41. According to our data, TNF A -238G>A and IL-10 -1082A>G, -819C>T and -592C>A may be associated with the development of prostate cancer and BPH. We could also notice higher frequency of TNF A and IL-10 risk haplotypes in smoker and alcohol user. Interestingly, IL-10 risk haplotype was positively associated with aggressiveness of tumor. PMID: 28993831
  42. Local IL-10 and IL-13 upregulation in IgG4-abdominal aortic aneurysms was related to Th2 and Treg-predominant cytokine balance. PMID: 28434701
  43. Suggest that the interaction between macrophages and endometrial stromal cells downregulates cytotoxicity of NK cells possibly by stimulating the secretion of IL-10 and TGF-beta, and may further trigger the immune escape of ectopic fragments and promote the occurrence and the development of endometriosis. PMID: 28971893
  44. isatuximab decreases multiple myeloma cell- and bone marrow stromal cell-induced iTreg by inhibiting both cell-cell contact and TGFbeta/IL10. Finally, CD38 levels correlate with differential inhibition by isatuximab of Tregs from multiple myeloma versus normal donors.Targeting CD38 by isatuximab can preferentially block immunosuppressive Tregs and thereby restore immune effector function against multiple myeloma PMID: 28249894
  45. Activation of PAR2 inhibits the expression of IL-10 in B cells, which can be reversed by treating B cells with Bcl2L12 shRNA-carrying liposomes. PMID: 28426164
  46. Serum IL-17 and IL-23 values positively correlated with serum total IgE levels. Serum levels of IL-10 were lower in children with atopy and dyslipidemia than patients with dyslipidemia. PMID: 28692864
  47. This meta-analysis concludes that IL-10 -1082 gene polymorphism is not significantly associated with overall, Asian and African population. However, this polymorphism is associated with Caucasian population. PMID: 28951522
  48. The data suggest that IL-10, but not IL-37, may have potential as a biomarker predictive for disease activity in Systemic lupus erythematosus. PMID: 27708376
  49. In the study, 250 ONFH patients and 228 matched healthy controls from Shandong Province were recruited to evaluate the influence of interleukin-10 (IL-10) rs1800872, IL-12 rs3212227 and tumor necrosis factor-(TNF-alpha) rs1800629 polymorphism in osteonecrosis of the femoral head (ONFH). IL-12 rs3212227 AC genotype confer genetically susceptibility to ONFH in the Chinese Han population. PMID: 28980933
  50. Gene polymorphisms of TNF-238G/A, TNF-308G/A, IL10-1082G/A, TNFAIP3, and MC4R and comorbidity occurrence in a Romanian population with psoriasis PMID: 29696068

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
IL-10 family
Tissue Specificity
Produced by a variety of cell lines, including T-cells, macrophages, mast cells and other cell types.
Database Links

HGNC: 5962

OMIM: 124092

KEGG: hsa:3586

STRING: 9606.ENSP00000412237

UniGene: Hs.193717

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*