Code | CSB-MP023983HU1 |
Size | $428 |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
A DNA fragment encoding amino acid residues Phe19 to Lys379 of the human TNFRSF8 was fused with a Myc-tag at the C-terminus and a 10xHis tag at the N-terminus and then expressed in mammalian cells. The product is the recombinant human TNFRSF8 protein. Its purity is greater than 95% determined by SDS-PAGE. Under reducing conditions, the TNFRSF8 protein migrated to the molecular mass band of approximately 66 kDa on the gel. Its endotoxin content is less than 1.0 EU/ug measured by the LAL method. It is an active protein, and its bioactivity was measured through the functional ELISA. It can bind to CD30L with the EC50 of 14.96-20.25 ng/ml. This recombinant TNFRSF8 protein is in stock now. TNFRSF8, also called CD30, is normally expressed by activated T- and B-lymphocytes and NK cells. Upon binding to CD30L, CD30 may participate in Th1 and Th2 cell responses and plays a key role in Th17 differentiation and Th1-, and Th2-related diseases. Upregulation of CD30 expression is found in various hematological malignancies, including anaplastic large cell lymphoma (ALCL) and subsets of Non-Hodgkin’s lymphomas (NHLs). |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized CD30 at 5 μg/ml can bind human CD30L(CSB-MP023996HU1c9), the EC50 is 14.96-20.25 ng/ml. |
Target Names | TNFRSF8 |
Uniprot No. | P28908 |
Alternative Names | TNFRSF8; CD30; D1S166E; Tumor necrosis factor receptor superfamily member 8; CD30L receptor; Ki-1 antigen; Lymphocyte activation antigen CD30; CD antigen CD30 |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 19-379aa |
Target Protein Sequence | FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK |
Mol. Weight | 43.5 kDa |
Protein Length | Partial |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Receptor for TNFSF8/CD30L. May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF-kappa-B.
|
Gene References into Functions |
|
Subcellular Location | [Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Cytoplasm. |
Tissue Specificity | [Isoform 2]: Detected in alveolar macrophages (at protein level). |
Database Links |
HGNC: 11923 OMIM: 153243 KEGG: hsa:943 STRING: 9606.ENSP00000263932 UniGene: Hs.1314 |