Recombinant Human Tumor necrosis factor receptor superfamily member 8 (TNFRSF8), partial (Active)

In Stock
Code CSB-MP023983HU1
Abbreviation Recombinant Human TNFRSF8 protein, partial (Active)
MSDS
Size $102
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized CD30 at 5 μg/ml can bind human CD30L(CSB-MP023996HU1c9), the EC50 is 14.96-20.25 ng/ml. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized CD30 at 5 μg/ml can bind human CD30L(CSB-MP023996HU1c9), the EC50 is 14.96-20.25 ng/ml.
Target Names
Uniprot No.
Alternative Names
TNFRSF8; CD30; D1S166E; Tumor necrosis factor receptor superfamily member 8; CD30L receptor; Ki-1 antigen; Lymphocyte activation antigen CD30; CD antigen CD30
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
19-379aa
Target Protein Sequence
FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK
Mol. Weight
43.5 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

CD30 (TNFRSF8) serves as a critical costimulatory receptor in Hodgkin lymphoma biology and T-cell activation, making precise characterization of its ligand interactions essential for oncology-focused drug discovery. This recombinant human CD30 ectodomain, spanning residues 19–379, is produced in mammalian cells to preserve native glycosylation and disulfide-dependent folding required for authentic CD30L engagement. Functional ELISA confirms robust binding to human CD30L with an EC50 of 14.96–20.25 ng/ml, providing a validated basis for ligand-receptor interaction assays, competitive blocking antibody screening, therapeutic antibody epitope mapping, and affinity characterization by SPR or BLI. The protein carries N-terminal 10×His and C-terminal Myc tags for flexible immobilization strategies, and with purity exceeding 95% by SDS-PAGE alongside endotoxin levels below 1.0 EU/μg, it meets the quality thresholds commonly required for cell-based functional assays and sensitive binding studies in cancer research.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : Binding assay/Protein-protein interaction

Review: After receiving the product, we performed SDS-PAGE detection and found that the purity was higher than the standard. The binding activity between TNFRSF8 (CD30) and CD30L was verified by a functional ELISA to be very good, and the EC50 was 9.531-12.49 ng/ml. The protein has stable performance, good repeatability, and small inter-batch differences, which can be used for subsequent research! The product is easy to use and worth being recommended!

By Anonymous

Target Background

Function
Receptor for TNFSF8/CD30L. May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF-kappa-B.
Gene References into Functions
  1. Data suggest that CD4+ T cell-associated HIV-1 RNA is often highly enriched in cells expressing CD30; cells expressing this marker considerably contribute to total pool of transcriptionally active CD4+ lymphocytes in individuals on suppressive anti-retroviral drug therapy; CD30 may be a marker of residual, transcriptionally active HIV-1 infected cells in blood and in gut-associated lymphoid tissue. PMID: 29470552
  2. The stable elevation in classical Hodgkin lymphoma risk with elevated levels of sCD30 and IL6 across 4 or more years prior to diagnosis may also reflect a B-cell-stimulatory environment that promotes the genesis of these cancers. PMID: 28341757
  3. extranodal NK/T-cell lymphoma, nasal type(ENKTL) is the most common type of mature T-cell and NK-cell lymphoma diagnosed at our institution. CD30 is frequently expressed in ENKTL and represents a therapeutic target; however, it may not be a prognostic marker. PMID: 28486951
  4. This study suggests that in patients with CD30+ lymphoproliferative disorders, an aggressive clinical course cannot be defined by the presence of TP63 rearrangements, as was recently shown in systemic ALK negative anaplastic large cell lymphoma. PMID: 27146432
  5. Data suggest that Brentuximab Vedotin (SGN-35) damaged CD30 ligand (CD30L)-immune cells through CD30 extracellular vesicles (EVs). PMID: 27105521
  6. median FoxP3+ Treg count was higher in CD30+ than in CD30- posttransplant lymphoproliferative disorders, 3.0 vs 0 PMID: 29126177
  7. Variant histology is common in pediatric NLPHL, especially types C and E, which are associated with IgD expression. Type C variant histology and possibly type D are associated with decreased EFS, but neither IgD nor CD30 are adverse features. Variant histology may warrant increased surveillance, but did not affect overall survival. PMID: 28802087
  8. Expression of CD30 in patients with both DLBCL and other aggressive B-cell lymphomas and the absence of MYC oncogene-driven proliferation in the majority of these tumors suggests that brentuximab may be a particularly effective form of targeted therapy in the subset of patients with high CD30 expression. PMID: 27521276
  9. Prevalence of the CD30 (Ki-1) antigen in human solid tumors was summarized. PMID: 28427526
  10. Higher serum sCD30 levels were associated with an increased risk of bacterial infection after kidney transplantation. PMID: 28122147
  11. CD30 expression was detected in up to 25% of cases of diffuse large B-cell lymphoma and was more frequent in tumors without MYC rearrangement. CD30 expression was not associated with overall survival in R-EPOCH-treated de novo DLBCL patients. PMID: 27816715
  12. CD30 facilitates phosphorylation of heat shock factor 1, activates heat shock promoter element, and induces heat shock protein (HSP) 90. PMID: 27870927
  13. this study shows that polyclonal and allogeneic stimulation induced higher levels of CD30 transcripts in end-stage renal disease patients compared to control patients PMID: 26970513
  14. CD30 expression was not associated with prognosis in our cohort of de novoDLBCL, including in patients who received aggressive chemotherapy. CD30 expression and MYC rearrangement were mutually exclusive in de novoDLBCL. PMID: 26340843
  15. Case Report: CD30 positive lymphomatoid papulosis arising in association with cutaneous amyloidosis in a patient with multiple myeloma. PMID: 26981738
  16. The heterogeneity of CD30 expression in refractory or relapsed peripheral T-cell lymphoma patients indicates the likelihood for better response for patients with strong CD30 expression by tumor cells. PMID: 26703966
  17. CD30 may be useful as a prognostic marker in rituximab, cyclophosphamide, doxorubicin, vincristine, and prednisone (R-CHOP) treated DLBCLs, indicating favorable outcomes in a Chinese population. PMID: 26884853
  18. this review is focused on the role of CD30 receptor and p53 as novel targets for therapy in ALK+ ALCL, and also provides an update on their potential involvement in ALK+ ALCL pathogenesis PMID: 26709646
  19. Most angioimmunoblastic T-cell lymphoma and peripheral T-cell lymphoma-not otherwise specified express variable levels of CD30. PMID: 26574847
  20. Upregulated expression of CD30 is commonly found in sclerosing angiomatoid nodular transformation of the spleen. PMID: 26261484
  21. Our results demonstrated significantly elevated sCD30 levels in AS patients compared to healthy controls (HCs) with mean values of 32.0 +/- 12.2 and 24.9 +/- 8.0 ng/mL, (P(**) = 0.007), suggesting a p role of sCD30 in the pathogenesis of AS. PMID: 26273636
  22. With the introduction of the immunoconjugate brentuximab vedotin, the CD30 antigen has become an effectively targetable molecule. Therefore, we investigated the frequency and level of CD30 expression in post-transplant lymphoproliferative disorders. PMID: 25248878
  23. Data susggest that CD30 antigen may be useful as a prognostic factor and therapeutic target in extranodal natural killer/T-cell lymphoma (NKTCL). PMID: 25288491
  24. Data indicate that CD30 antigen downregulation and P-Glycoprotein (MDR1) upregulation are associated with drug resistance to brentuximab vedotin. PMID: 25840583
  25. Intralymphatic variant of ALCL and LyP may be explained, at least in part, by a particular lymphotropism of the neoplastic cells of cutaneous CD30 lymphoproliferative disorders. PMID: 26371781
  26. BAG-3 expression correlated with increased HSP70 expression in a subset of systemic T cell lymphoma cases co-expressing the CD30 antigen. PMID: 24492285
  27. These results show that high sCD30 levels are independent predictors of graft dysfunction PMID: 25698648
  28. Single threonine residue at position 61 in CD30v that is critical for TRAF2 interaction, NFkappaB activation, and downstream CD30-NFkappaB-dependent phenotypes in hESCs was identified. PMID: 25568342
  29. Case Report: describe a CD30+ lymphoproliferative rash exhibiting a predilection for recurrence on the same skin sites. PMID: 24733405
  30. case Report: primary cutaneous CD30+ anaplastic large cell lymphoma treated successfully with brentuximab vedotin. PMID: 24733422
  31. Elevated serum sCD30 is associated with increased risk of non-Hodgkin lymphoma. PMID: 25567136
  32. Case Report: suggest Sezary syndrome, CD30 anaplastic large-cell lymphoma, and mycosis fungioides are interrelated. PMID: 25548993
  33. levels of serum sCD30 tend to be higher in individuals with atopy. Improvement in lung function seems to be associated with a decrease in sCD30 in children with atopy and troublesome lung symptoms. PMID: 25492095
  34. occurs in a significant subset of angiosarcomas and epithelioid hemangioendotheliomas PMID: 24805132
  35. findings uncover the oncogenic role of the JUNB/CD30 axis and its potential as therapeutic target in ALK+ ALCL. PMID: 25145835
  36. Data indicate a chimeric fusion involving nucleophosmin NPM1 (5q35) and TYK2 kinase (19p13) that encodes an NPM1-TYK2 protein in cutaneous CD30 antigen-positve lymphoproliferative disorders. PMID: 25349176
  37. is expressed in a substantial proportion of DLBCL and CD30 immunohistochemistry may be a useful prognostic marker in R-CHOP treated GCB-DLBCL. PMID: 25135752
  38. The expression of CD30 by mastocytosis mast cells may influence the clinical phenotype and management of mastocytosis. (Review) PMID: 24745678
  39. a substantial subset of patients with T-ALL have lymphoblasts that express surface CD30. CD30 expression by T-lymphoblasts also appears to be up-regulated in patients who are treated with high-dose chemotherapy. PMID: 23937105
  40. Suggest intralymphatic cutaneous anaplastic large cell lymphoma/lymphomatoid papulosis are part of an expanding spectrum of CD30-positive lymphoproliferative disorders. PMID: 24805854
  41. higher serum levels in Ewing sarcoma patients with primary bone tumors PMID: 24375064
  42. diagnostic and prognostic value of CD30 expression in systemic mastocytosis as assessed by multiparameter flow cytometry PMID: 24111625
  43. this study highlights a novel SATB1-p21 axis that plays an important role in the disease progression of cutaneous CD30+LPDs, which provides novel molecular insights into this disease and possibly leads to new therapies in the future. PMID: 24747435
  44. serum concentration during pregnancy is not associated with pre-eclampsia and recurrent pregnancy loss PMID: 23268289
  45. CD30 expression on lymphomatous cells makes an attractive target for drug-conjugated antibody-directed therapies. PMID: 23716537
  46. CD30(+) peripheral T-cell lmyphomas differed significantly from CD30(-) samples. PMID: 23716562
  47. Post-transplant sCD30 serum levels, especially in conjunction with information regarding HLA class II antibodies and serum creatinine levels, provide valuable information regarding graft outcome PMID: 23928467
  48. Malignant Hodgkin and Reed-Sternberg cells release CD30 on the surface of extracellular vesicles facilitating CD30-CD30L interaction between cell types. PMID: 24659185
  49. High pretransplant levels of serum soluble CD30 can be a risk factor for kidney transplant rejection, and its high negative predictive value at various cutoffs make it useful to find candidates with a low risk of acute rejection after transplant. PMID: 23477385
  50. Soluble CD30 levels are significantly reduced in combination immunosuppression but are differentially affected by different immunosuppressant agents. PMID: 23503451

Show More

Hide All

Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Cytoplasm.
Tissue Specificity
[Isoform 2]: Detected in alveolar macrophages (at protein level).
Database Links

HGNC: 11923

OMIM: 153243

KEGG: hsa:943

STRING: 9606.ENSP00000263932

UniGene: Hs.1314

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*