Home
Active Protein
Other
Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active)

Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active)

^{In Stock}

Code	CSB-EP008625BOe1
Abbreviation	Recombinant Bovine FGF2 protein (Active)
MSDS	MSDS Datasheet
Size	$554
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity The ED50 as determined by the dose-dependent stimulation of the proliferation of NIH-3T3 cells is 0.9252-2.630 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

The ED50 as determined by the dose-dependent stimulation of the proliferation of NIH-3T3 cells is 0.9252-2.630 ng/mL.

Target Names

FGF2

Uniprot No.

P03969

Alternative Names

Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor (bFGF); Heparin-binding growth factor 2 (HBGF-2); Kidney-derived growth factor; FGF2

Species

Bos taurus (Bovine)

Source

E.coli

Expression Region

10-155aa

Target Protein Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

Mol. Weight

16.5 kDa

Protein Length

Full Length of Mature Protein

Tag Info

Tag-Free

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

FGF2 orchestrates cell proliferation, survival, and angiogenesis by binding heparan sulfate proteoglycans and activating FGFR tyrosine kinase signaling, making it a central regulator in wound healing, neural development, and tumor vascularization. This tag-free bovine FGF2, spanning the complete mature protein (aa 10–155), demonstrates dose-dependent mitogenic activity on NIH-3T3 fibroblasts with an ED50 of 0.9252–2.630 ng/mL, confirming receptor-binding potency suitable for cell proliferation assays, stem cell maintenance protocols, and angiogenesis models. Expressed in E. coli to yield an unglycosylated form that retains full biological function, the protein aligns with standards expected in receptor-ligand binding studies, including surface plasmon resonance and competitive ELISA formats. Purity exceeding 95% by SDS-PAGE and endotoxin below 1.0 EU/μg meet the quality thresholds commonly required for in vitro differentiation experiments and antibody validation workflows.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation.

Subcellular Location

Secreted. Nucleus.

Protein Families

Heparin-binding growth factors family

Database Links

STRING: 9913.ENSBTAP00000007477

UniGene: Bt.66957

Promotions