Recombinant Bovine Insulin-like growth factor I (IGF1)

In Stock
Code CSB-EP011086BO
Abbreviation Recombinant Bovine IGF1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
IGF-I;Somatomedin
Species
Bos taurus (Bovine)
Source
E.coli
Expression Region
50-119aa
Target Protein Sequence
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
14.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation. Ca(2+)-dependent exocytosis of IGF1 is required for sensory perception of smell in the olfactory bulb. Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiatiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins ITGAV:ITGB3 and ITGA6:ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling. Induces the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2 and AKT1.
Gene References into Functions
  1. These results suggest that reduced secretions of IGF-I, INSL3, and inhibin surrounding puberty may be associated with semen aberration in beef bulls. PMID: 29597124
  2. IGF1/RsaI was associated with average daily weight gain in cattle. PMID: 29023078
  3. Thus CR suppresses the hypertrophic PGC1alpha-4/IGF-1/AKT1 pathway while promoting activation of the calpain system. PMID: 28228415
  4. Data suggest that both ovarian follicular dominance in cows and cooperation of ovarian follicles in pigs can be mediated by either down- or up-regulation of the insulin-like growth factor 1/oxytocin system. PMID: 28163019
  5. IGF1 single nucleotide polymorphisms associated with milk fatty acids in a Chinese Holstein cattle. PMID: 27468856
  6. It has been shown that several specific genes which are differentially regulated, including IGF-1, might impact dairy fertility. PMID: 27514375
  7. There was no association between the genotypes of GH and IGF-IS and fertility of Holstein cows raised in semiextensive or intensive regimes, while the STAT5 ABstEII polymorphism was associated with calving-first heat interval in Holstein cows raised in the intensive system. PMID: 27865414
  8. Associations between genetic variants in the promoter region of the insulin-like growth factor-1 (IGF1) gene and blood serum IGF1 concentration in Hanwoo cattle. PMID: 25966067
  9. The association of IGF1, GH, and PIT1 markers with growth and reproductive traits were assessed. PMID: 25258122
  10. These findings strongly support the concept that IGF-1 upregulates LHR expression in granulosa cells and that IGF-1 is required for determining which follicle becomes dominant and acquires ovulatory capacity. PMID: 25626338
  11. Insulin-induced glucose uptake in lactating bovine mammary epithelial cells may involve the phosphatidylinositide 3-kinase- but not mitogen-activated protein kinase-mediated signaling pathways. PMID: 24731625
  12. Data show that individuals with insulin-like growth factor I (IGF-1) allele C had a significantly higher performance in production traits. PMID: 25177970
  13. Uterine concentrations of IGFBPs are cycle stage specific and also suggests IGF1-dependent and -independent functions for IGFBPs during a time of major change in the developing embryo. PMID: 23607981
  14. This study evaluated the relationship of IGF-I levels to several other determinants of feed intake in Red Angus cross cattle. PMID: 24085409
  15. Production and reproduction traits in Holstein cattle associated with single nucleotide polymorphisms in the IGF1 gene. PMID: 24530703
  16. There is a strong association between putative favorable allelic variants (SNP) of neuropeptide Y, leptin, and IGF-1 genes, and residual feed intake, when animals were grazing on a high-quality, high-availability pasture. PMID: 23881687
  17. Direct additive genetic correlations suggest that selection for greater IGF-I concentration could lead to increased conception rate and calving rate, and decreased age at first calving in heifers. PMID: 23894000
  18. We found that IGF-I stimulated chondrocyte biosynthesis similarly when delivered by either exogenous or endogenous means. PMID: 24105960
  19. Results herein remark the important role of the IGF-1gene in the fertility of dairy cows on early lactation and make the SNP IGF-1/SnaBI an interesting candidate marker for genetic improvement of fertility in dairy cattle. PMID: 23409757
  20. Both the MEK/ERK and PI3K/AKT pathways mediate the stimulatory effect of IGF-I on myoblast proliferation. PMID: 23541948
  21. Polymorphisms associated with IGF1 are linked to reproductive traits in cattle. PMID: 23785023
  22. A significant allele substitution effect was found for IGF1 and yearling weight in Nelore beef cattle. PMID: 23079978
  23. The relationship of postpartum variations of plasma IGF-1 and IGFBP concentrations, oocyte production and quality to parity and subsequent conception rate in Holstein dairy cows is reported. PMID: 22734498
  24. The reduction in IGFs mRNA level after 5 days of life in the duodenum (IGF-1 and IGF-2) and in the jejunum (IGF-1) was associated with reduction in villi length (duodenum and jejunum) and the increase of crypt depth (duodenum). PMID: 22439332
  25. Two IGF-1 SNPs, IGF1i1 and IGF1i2, were significantly associated with body condition score at calving, while a single IGF-1 SNP, IGF1i3, was significantly associated with milk production, including milk yield. PMID: 21948746
  26. GH and IGF-I genotypes had no substantial effect on productive parameters, though IGF-I genotype affected calving-first service interval in primiparous cows. However, the genotypes do alter the endocrine/metabolic profiles of the transition dairy cow. PMID: 21635772
  27. Exogenous recombinant bovine somatotropin did not affect plasma concentrations of IGF-I and insulin, however, it did improve post-thaw sperm membrane integrity. PMID: 19663813
  28. Data describes the long-term changes to skeletal muscle growth and IGF1, 2, 1R, and 2R mRNA expression in progeny after exposure to high and low levels of maternal nutrient intake during the first two trimesters of gestation in the bovine. PMID: 21056085
  29. It was concluded that TGF-alpha and TGF-beta 1, 2 and 3 are present in the testis of the bull calf, and changes in concentrations with age suggest a functional role in the development of the testis. PMID: 19210668
  30. IGF-I gene polymorphism, but not its blood concentration, is associated with milk fat and protein in Holstein dairy cows. PMID: 20812193
  31. analysis of IGF1 gene polymorphisms and their effect on growth traits in Mexican beef cattle PMID: 20467980
  32. IGF-1 and IGF-1r gene polymorphisms in East Anatolian Red and South Anatolian Red cattle breeds. PMID: 20536020
  33. effects of insulin, IGF-I and IGF-II on apoptosis and cell proliferation in bovine blastocysts in vitro PMID: 12112582
  34. Autokinase activity of IGF-IR in esophageal carcinoma cell line can be triggered by the exogenous addition of IGF-I. PMID: 12432233
  35. IGF1 has a role in chondrocyte biosynthesis in cartilage explants PMID: 12781774
  36. Food deprivation-induced decrease in circulating IGF-I in steers is associated with decrease in expression of different IGF-I mRNA variants and specific decrease in expression of growth hormone receptor mRNA variants 1C3 and 1A in liver. PMID: 12888636
  37. Data show that 9-cis-retinoic acid enhanced midkine gene expression, but not insulin-like growth factor-I gene expression, in cumulus-granulosa cells. PMID: 14502603
  38. Concentrations of IGF-I in fetal plasma, as determined by RIA, were significantly higher (P = 0.001) in nuclear transfer pregnancies PMID: 14561651
  39. 3 haplotypes with an allele of igf1 showed significant associations with growth traits PMID: 14753343
  40. allele and genotype frequencies of microsatellite markers located in the 5'-regulatory region of the IGF1 and GHR genes in beef cattle and effects of these markers on growth and carcass traits in an intensive production system PMID: 15670132
  41. Plasma IGF-1 level and night plasma melatonin tended (P = 0.10) to be negatively correlated in prepubertal heifers. Light intensities of 10 lx or less had no effect on plasma IGF-1. PMID: 16499558
  42. GH dramatically inhibits the expression of IGFBP-5, and GH along with IGF-I enhanced the phosphorylation of Akt through the reduction of IGF binding protein (IGFBP)-5. PMID: 16698222
  43. GH, IGF-I and IGF-IBP3 regulated the growth and development traits in different growth period. PMID: 16870578
  44. Characterization of single nucleotide polymorphisms in IGF1 in relation to production traits. PMID: 16879354
  45. postweaning serum IGF-I concentration is moderately to highly heritable and has small positive genetic, environmental, and phenotypic correlations with BW other than birth weight and with pre- and postweaning gain PMID: 16908632
  46. IGF-I plays a role in the regulation of folliculogenesis, and may participate in the pathogenesis of cystic ovarian disease in cattle. PMID: 17631370
  47. localized autocrine IGF-I activity might lead to increased permeability via changes in both the tight and adherens junction protein levels PMID: 17668352
  48. results support the hypotheses that IGF1 plays a role in colonic carcinogenesis and that genetically inherited variation in IGF1 expression influences risk of colorectal cancer. PMID: 18308828
  49. IGF-I plays a role in E2- and trenbolone acetate-stimulated proliferation of cultured BSC even in the absence of increased IGF-I expression. PMID: 18403176
  50. delivery of insulin-like growth factor-1 (IGF-1, delivered at concentrations of 0, 10, 50, and 100 ng/mL) affects the endogenous expression of IGF-1, its receptor (IGF-1R), and a well known IGF-1 binding protein (IGFBP-3) by articular chondrocytes PMID: 18491951

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Insulin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*