Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis CLDN6 at 5 μg/mL can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU). The EC50 is 4.186-6.635 ng/mL.The VLPs (CSB-MP3838) is negative control.

Target Names

CLDN6

Uniprot No.

A0A0D9SBX5

Alternative Names

/

Species

Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)

Source

Mammalian cell

Expression Region

22-220aa

Target Protein Sequence

LVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSRGPSHYMARYSTSAPAISRGPSEYPTKNYV

Mol. Weight

22.6kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).

Datasheet & COA

Please contact us to get it.

Description

The Recombinant Chlorocebus sabaeus CLDN6 is a high-purity, full-length antigen presented in a Virus-Like Particle (VLP) format, specifically derived from the Green monkey species. The VLP platform provides a critical advantage by mimicking the natural structure of a virus, thereby significantly enhancing immunogenicity without any risk of infection and enabling the multivalent presentation of the target antigen. This recombinant CLDN6, expressed in a mammalian cell system, corresponds to the mature protein's full extracellular domain (22-220aa) and is C-terminally 10xHis-tagged. The product's quality and functionality are rigorously validated: Western Blot analysis using an anti-6*His antibody confirms a specific band at the expected size, and a functional ELISA demonstrates its high, specific binding activity to an Anti-CLDN6/9 recombinant antibody, with an EC₅₀ of 4.186-6.635 ng/mL, while control VLPs show no binding. With an endotoxin level below 1.0 EU/µg, this reagent offers a potent, safe, and structurally advanced immunogen for vaccine research and antibody development targeting CLDN6 in a non-human primate model.

Code	CSB-MP6148GKN
Abbreviation	Recombinant Chlorocebus sabaeus CLDN6 protein-VLPs (Active)
MSDS	MSDS Datasheet
Size	$620
	Order now
Image	CSB-MP025131HU is detected by Mouse anti-6*His monoclonal antibody. Activity Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis CLDN6 at 5 μg/ml can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU). The EC₅₀ is 4.186-6.635 ng/mL.The VLPs (CSB-MP3838) is negative control. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Chlorocebus sabaeus Claudin (CLDN6)-VLPs (Active)

Product Details

Customer Reviews and Q&A

×CloseMessage