Home
Active Protein
Other
Recombinant Chlorocebus sabaeus Claudin (CLDN6)-VLPs (Active)

Recombinant Chlorocebus sabaeus Claudin (CLDN6)-VLPs (Active)

^{In Stock}

Code	CSB-MP6148GKN
Abbreviation	Recombinant Chlorocebus sabaeus CLDN6 protein-VLPs (Active)
MSDS	MSDS Datasheet
Size	$620
	Order now
Image	CSB-MP025131HU is detected by Mouse anti-6*His monoclonal antibody. Activity Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis CLDN6 at 5 μg/ml can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU). The EC₅₀ is 4.186-6.635 ng/mL.The VLPs (CSB-MP3838) is negative control. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Customer Reviews and Q&A

Product Details

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis CLDN6 at 5 μg/mL can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU). The EC50 is 4.186-6.635 ng/mL.The VLPs (CSB-MP3838) is negative control.

Target Names

CLDN6

Uniprot No.

A0A0D9SBX5

Alternative Names

Species

Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)

Source

Mammalian cell

Expression Region

22-220aa

Target Protein Sequence

LVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSRGPSHYMARYSTSAPAISRGPSEYPTKNYV

Mol. Weight

22.6kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).

Datasheet & COA

Please contact us to get it.

Description

Claudin-6 is a tight junction protein aberrantly expressed in several solid tumors, making it a promising target for cancer immunotherapy and antibody-based diagnostics. This full-length mature protein (aa 22–220) presented on virus-like particles demonstrates specific antibody binding in functional ELISA, with an EC50 of 4.186–6.635 ng/mL when tested against an anti-CLDN6/9 recombinant antibody, confirming that the native epitope architecture is preserved. The VLP format provides multivalent antigen display that closely mimics cell surface presentation, supporting use in antibody development and validation workflows where physiologically relevant binding kinetics are essential. With endotoxin levels below 1.0 EU/μg, this reagent aligns with standards expected in cell-based assays for tumor metastasis research and immune cell trafficking studies where low endotoxin is critical for maintaining cellular responsiveness.