Recombinant Chlorocebus sabaeus Claudin (CLDN6)-VLPs (Active)

In Stock
Code CSB-MP6148GKN
Abbreviation Recombinant Chlorocebus sabaeus CLDN6 protein-VLPs (Active)
MSDS
Size $630
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156 Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis CLDN6 at 5 μg/mL can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU). The EC50 is 4.186-6.635 ng/mL.The VLPs (CSB-MP3838) is negative control.
Target Names
Uniprot No.
Alternative Names
/
Species
Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)
Source
Mammalian cell
Expression Region
22-220aa
Target Protein Sequence
LVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSRGPSHYMARYSTSAPAISRGPSEYPTKNYV
Mol. Weight
22.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Datasheet & COA
Please contact us to get it.
Description

This recombinant Chlorocebus sabaeus CLDN6 protein is produced in mammalian cells as a virus-like particle (VLP), incorporating amino acids 22 to 220 of the native CLDN6 sequence. It carries a C-terminal 10xHis tag for convenient purification and detection. Provided as a lyophilized powder, the protein has an endotoxin level below 1.0 EU/μg, confirmed via the LAL method. Its biological activity is validated through a functional ELISA. It binds to an anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU), yielding an EC50 ranging from 4.186 to 6.635 ng/mL. A VLP control (CSB-MP3838) shows no binding, supporting assay specificity.

The CLDN6 protein, a member of the claudin family, is known to contribute significantly to cell adhesion and the formation of tight junctions, which are crucial for maintaining epithelial barrier integrity. In the context of Chlorocebus sabaeus, commonly known as the African Green Monkey, CLDN6 likely regulates paracellular transport and the selective permeability of epithelial layers. Although specific studies focusing solely on CLDN6 in C. sabaeus are limited, relevant data from related research can provide insights into its potential roles and functions.

Firstly, CLDN6 has been implicated in the context of viral infections and interactions with immune responses in primates. For instance, the study by Heigele et al. highlights the role of claudin proteins in viral pathogenesis, particularly how lentiviral proteins can manipulate cellular pathways to downregulate host immune responses, which indirectly implies the importance of CLDN6 [1]. Given that C. sabaeus is an important model organism for simian immunodeficiency virus (SIV) research, understanding how CLDN6 interacts with these viral mechanisms could elucidate its function in viral pathogenesis and immunity.

Furthermore, the genomic analysis of C. sabaeus, particularly in Vero cells derived from this species, has provided a framework for exploring gene expression patterns and the involvement of tight junction proteins like CLDN6 in response to viral infections [2]. Notably, previous studies have underscored the significance of claudins in maintaining barrier function during viral infections, suggesting that manipulating these pathways could enhance our understanding of SIV infectivity and pathogenesis in African Green Monkeys [3].

Additionally, research involving the immune response to SIV in C. sabaeus has indicated the importance of maintaining epithelial integrity, potentially linked to CLDN6 functions. Studies have noted that the claudin protein family contains essential markers in understanding how primate models resist pathogenic infections while often remaining asymptomatic despite SIV presence [4]. Understanding the nuances of CLDN6's expression and its regulatory mechanisms may, therefore, contribute to unraveling the complex interactions between host genetics and viral persistence in this model species.

Lastly, recent analyses of the African Green Monkey microbiome also suggest that microbial interactions can influence claudin gene expression, including CLDN6, further indicating its broader role in health and disease in primate models [5]. Thus, while direct studies on CLDN6 in Chlorocebus sabaeus are scarce, its involvement in tight junction integrity, immunity, and microbiota interactions positions it as a novel target for future research examining host-pathogen dynamics in this species.

References:
[1] A. Heigele, M. Schindler, C. Gnanadurai, J. Leonard, K. Collins, & F. Kirchhoff. Down-modulation of cd8αβ is a fundamental activity of primate lentiviral nef proteins. Journal of Virology, vol. 86, no. 1, p. 36-48, 2012. https://doi.org/10.1128/jvi.00717-11
[2] C. Sakuma, T. Sekizuka, et al. Novel endogenous simian retroviral integrations in vero cells: implications for quality control of a human vaccine cell substrate. Scientific Reports, vol. 8, no. 1, 2018. https://doi.org/10.1038/s41598-017-18934-2
[3] N. Osada, A. Kohara, et al. The genome landscape of the african green monkey kidney-derived vero cell line. Dna Research, vol. 21, no. 6, p. 673-683, 2014. https://doi.org/10.1093/dnares/dsu029
[4] M. Ploquin, Y. Madec, et al. Elevated basal pre-infection cxcl10 in plasma and in the small intestine after infection are associated with more rapid hiv/siv disease onset. Plos Pathogens, vol. 12, no. 8, p. e1005774, 2016. https://doi.org/10.1371/journal.ppat.1005774
[5] B. Jacquelin, G. Petitjean, et al. Innate immune responses and rapid control of inflammation in african green monkeys treated or not with interferon-alpha during primary sivagm infection. Plos Pathogens, vol. 10, no. 7, p. e1004241, 2014. https://doi.org/10.1371/journal.ppat.1004241

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*