Recombinant Danio rerio Superoxide dismutase [Cu-Zn] (sod1)

In Stock
Code CSB-EP022397DIL
Abbreviation Recombinant Zebrafish SOD1 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
sod1; cuzn; Superoxide dismutase [Cu-Zn]; EC 1.15.1.1
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Source
E.coli
Expression Region
1-154aa
Target Protein Sequence
MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDKTHGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGNAGGRLACGVIGITQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.1kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Zebrafish sod1 contains amino acids 1-154. This sod1 protein is theoretically predicted to have a molecular weight of 37.1 kDa. This sod1 recombinant protein is manufactured in e.coli. The sod1 coding gene included the N-terminal 10xHis-SUMO tag and C-terminal Myc tag, which simplifies the detection and purification processes of the recombinant sod1 protein in following stages of expression and purification.

Superoxide dismutase [Cu-Zn] (Sod1) in Danio rerio, commonly known as zebrafish, is an essential antioxidant enzyme that plays a crucial role in the defense against oxidative stress. This enzyme is characterized by its ability to catalyze the dismutation of superoxide radicals into oxygen and hydrogen peroxide, thereby protecting cells from the harmful effects of reactive oxygen species. Sod1 is primarily localized in the cytoplasm and is involved in maintaining cellular redox homeostasis. In zebrafish, as in other organisms, Sod1 is vital for various physiological processes, including embryonic development, immune response, and overall cellular survival. Studying Sod1 in zebrafish contributes to a better understanding of the mechanisms underlying oxidative stress responses and provides insights into the role of this enzyme in development and disease.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Destroys radicals which are normally produced within the cells and which are toxic to biological systems.
Gene References into Functions
  1. fenofibrate almost completely abolished GM-induced reactive oxygen species generation, which seemed to be mediated at least in part by the restoration of the expression of PPARalphadependent antioxidant enzymes, including catalase and superoxide dismutase (SOD)-1. PMID: 28290603
  2. The earliest event in the pathophysiology of amyotrohic lateral sclerosis in the mutant sod1 zebrafish model involves neuronal stress in inhibitory interneurons, resulting from mutant Sod1 expression. PMID: 23281025
  3. A hierarchic gene expression of copper homeostatic genes was demonstrated between atp7a, sp1 and sod1 in zebrafish. PMID: 21167140
  4. depresses cathepsin L activity stimulated by free radicals and prevents otic complications associated with bone erosion PMID: 11771045
  5. This isoform, when expressed in PC-12 cells affects t-butylhydroperoxide-induced apoptosis differentially from its isoenzyme. PMID: 12551919
  6. Copper/zinc superoxide dismutase was cloned from the zebrafish ( Danio rerio). Evidence is presented that SOD protects against paraquat toxicity in fish. PMID: 12876653
  7. Glia maturation factor-null cells ahow a concurrent decrease in CuZnSOD astrocytes. PMID: 15260123

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus.
Protein Families
Cu-Zn superoxide dismutase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*