Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

sod1

Uniprot No.

O73872

Research Area

Signal Transduction

Alternative Names

sod1; cuzn; Superoxide dismutase [Cu-Zn]; EC 1.15.1.1

Species

Danio rerio (Zebrafish) (Brachydanio rerio)

Source

E.coli

Expression Region

1-154aa

Target Protein Sequence

MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDKTHGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGNAGGRLACGVIGITQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

37.1kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The region for expressing recombinant Zebrafish sod1 contains amino acids 1-154. This sod1 protein is theoretically predicted to have a molecular weight of 37.1 kDa. This sod1 recombinant protein is manufactured in e.coli. The sod1 coding gene included the N-terminal 10xHis-SUMO tag and C-terminal Myc tag, which simplifies the detection and purification processes of the recombinant sod1 protein in following stages of expression and purification.

Superoxide dismutase [Cu-Zn] (Sod1) in Danio rerio, commonly known as zebrafish, is an essential antioxidant enzyme that plays a crucial role in the defense against oxidative stress. This enzyme is characterized by its ability to catalyze the dismutation of superoxide radicals into oxygen and hydrogen peroxide, thereby protecting cells from the harmful effects of reactive oxygen species. Sod1 is primarily localized in the cytoplasm and is involved in maintaining cellular redox homeostasis. In zebrafish, as in other organisms, Sod1 is vital for various physiological processes, including embryonic development, immune response, and overall cellular survival. Studying Sod1 in zebrafish contributes to a better understanding of the mechanisms underlying oxidative stress responses and provides insights into the role of this enzyme in development and disease.

Target Background

Function

Destroys radicals which are normally produced within the cells and which are toxic to biological systems.

Gene References into Functions

fenofibrate almost completely abolished GM-induced reactive oxygen species generation, which seemed to be mediated at least in part by the restoration of the expression of PPARalphadependent antioxidant enzymes, including catalase and superoxide dismutase (SOD)-1. PMID: 28290603
The earliest event in the pathophysiology of amyotrohic lateral sclerosis in the mutant sod1 zebrafish model involves neuronal stress in inhibitory interneurons, resulting from mutant Sod1 expression. PMID: 23281025
A hierarchic gene expression of copper homeostatic genes was demonstrated between atp7a, sp1 and sod1 in zebrafish. PMID: 21167140
depresses cathepsin L activity stimulated by free radicals and prevents otic complications associated with bone erosion PMID: 11771045
This isoform, when expressed in PC-12 cells affects t-butylhydroperoxide-induced apoptosis differentially from its isoenzyme. PMID: 12551919
Copper/zinc superoxide dismutase was cloned from the zebrafish ( Danio rerio). Evidence is presented that SOD protects against paraquat toxicity in fish. PMID: 12876653
Glia maturation factor-null cells ahow a concurrent decrease in CuZnSOD astrocytes. PMID: 15260123

Hide All

Subcellular Location

Cytoplasm. Nucleus.

Protein Families

Cu-Zn superoxide dismutase family

Database Links

KEGG: dre:30553

STRING: 7955.ENSDARP00000064375

UniGene: Dr.75822

Code	CSB-EP022397DIL
Abbreviation	Recombinant Zebrafish SOD1 protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Danio rerio Superoxide dismutase [Cu-Zn] (sod1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage