Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP004785HU |
| Product Type | Recombinant Protein |
| Size | US$1726 |
| Uniprot No. | O00585 |
| Relevance | Inhibits hopoiesis and stimulates chotaxis. Chotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs. Binds to atypical chokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | 6Ckine;Beta-chemokine exodus-2;Secondary lymphoid-tissue chemokine ;SLC;Small-inducible cytokine A21 |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP |
| Research Area | Immunology |
| Source | E.coli |
| Gene Names | CCL21 |
| Expression Region | 24-134aa |
| Tag Info | N-terminal GST-tagged |
| Mol. Weight | 39.3kDa |
| Protein Description | Full Length of Mature Protein |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4. |
| Subcellular Location | Secreted |
| Protein Families | Intercrine beta (chemokine CC) family |
| Tissue Specificity | Highly expressed in high endothelial venules of lymph nodes, spleen and appendix. Intermediate levels found in small intestine, thyroid gland and trachea. Low level expression in thymus, bone marrow, liver, and pancreas. Also found in tonsil, fetal heart |
| Database Links |
HGNC: 10620 OMIM: 602737 KEGG: hsa:6366 STRING: 9606.ENSP00000259607 UniGene: Hs.57907 |
| Pathway |
Chemokine signaling pathway
NF-kappa B signaling pathway |
CCL21 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA004785DA01HU | CCL21 Antibody | Human | ELISA, IHC |
| CSB-PA004785DB01HU | CCL21 Antibody, HRP conjugated | Human | ELISA |
| CSB-PA004785DC01HU | CCL21 Antibody, FITC conjugated | Human | ELISA |
| CSB-PA004785DD01HU | CCL21 Antibody, Biotin conjugated | Human | ELISA |
CCL21 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA576836 | CCL21 Antibody | Human | ELISA,IHC |
| CSB-PA929761 | CCL21 Antibody | Human | ELISA,IHC |
CCL21 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP004785HU CSB-BP004785HU CSB-MP004785HU |
Recombinant Human C-C motif chemokine 21(CCL21) | Yeast Baculovirus Mammalian cell |
| CSB-AP000941HU | Recombinant Human C-C motif chemokine 21 protein(CCL21) (Active) | E.Coli |
CCL21 ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-E04521h | Human secondary lymphoid-tissue chemokine,SLC ELISA Kit | serum, plasma | 20 pg/mL |
Recombinant Human Bone marrow proteoglycan(PRG2),partial
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Recombinant Mouse Guanine nucleotide-binding protein G(o) subunit alpha(Gnao1)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human E3 ubiquitin-protein ligase TRIM21(TRIM21)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Early growth response protein 1(EGR1),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Mouse Transcriptional repressor CTCFL(Ctcfl)
Express system: E.coli
Species: Mus musculus (Mouse)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.
