Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

CXCL3

Uniprot No.

P19876

Research Area

Immunology

Alternative Names

C-X-C motif chemokine 3; C-X-C motif chemokine ligand 3; Chemokine (C X C motif) ligand 3; Chemokine (CXC motif) ligand 3; Cinc 2; CINC 2b; Cinc2; CINC2b; CXCL 3; Cxcl3; CXCL3_HUMAN; Cytokine induced neutrophil chemoattractant 2; Dcip1; Dendritic cell inflammatory protein 1; Gm1960; GRO protein gamma; GRO-gamma; GRO-gamma(1-73); GRO-gamma(5-73); GRO3; GRO3 oncogene; GROG; Growth regulated protein gamma; Growth-regulated protein gamma; Macrophage inflammatory protein 2 beta precursor ; Macrophage inflammatory protein 2-beta; Melanoma growth stimulatory activity gamma; Member 3; MGSA gamma; MIP 2b; MIP2-beta; MIP2B; SCYB3; Small inducible cytokine subfamily B

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

35-107aa

Target Protein Sequence

ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

11.9kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Dive deeper into immunology research with our high-quality Recombinant Human CXCL3 protein. As a member of the C-X-C motif chemokine family, CXCL3 (also known as GRO3, GROG, or SCYB3) plays a significant role in the recruitment and activation of leukocytes, contributing to inflammation and immune response processes.

Our recombinant protein represents the full length of the mature human CXCL3, including the 35-107aa expression region. Expertly produced in E.coli, the protein features an N-terminal 6xHis-tag for simplified purification and detection. Boasting a purity greater than 90% as determined by SDS-PAGE, our Recombinant Human CXCL3 ensures a reliable product for your immunology investigations. Available in both liquid and lyophilized powder forms, this protein offers flexibility for your experimental requirements.

Target Background

Function

Ligand for CXCR2. Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes.

Gene References into Functions

CXCL3 exerts its carcinogenic potential by directly and/or indirectly regulating the downstream signaling pathways and the expression of transcription factors in PCa. PMID: 29524043
Exogenous CXCL3 induced Erk1/2 and ETS1 phosphorylation and promoted CD133 expression. PMID: 27255419
Our findings suggest that CXCL3 and its receptor CXCR2 are overexpressed in prostate cancer cells, prostate epithelial cells and prostate cancer tissues, which may play multiple roles in prostate cancer progression and metastasis. PMID: 26837773
results support a functional role of CXCL3 in breast cancer metastasis and as a viable target for cancer therapy PMID: 24605943
CXCL3 displays antimicrobial activity against E. coli and S. aureus. PMID: 12949249
secreted growth-regulated oncogene chemokines, specifically GRO-gamma, in human Mesenchymal stromal cell-conditioned media have an effect on the differentiation and the function of human monocyte-derived dendritic cells. PMID: 23589610
Data show that mesenchymal stem cells (MSCs) directly regulate T cell proliferation by induction of CXCL3 chemokine and its receptor, CXCR2 on the surface in T cells. PMID: 23023221
demonstrates, for the first time, that BIRC3 (anti-apoptotic protein), COL3A1 (matrix protein synthesis), and CXCL3 (chemokine) were up-regulated in the thrombin-stimulated human umbilical vein endothelial cells PMID: 16356540
GRO-gamma is a promising candidate for Th2-associated glomerular permeability factor in minimal change disease. PMID: 17389786
Inhibition of ERK phosphorylation decreased expression of GRO3. PMID: 17466952
Report gonadotropin-releasing hormone-regulated CXCL3 expression in human placentation. PMID: 19369450
propose that chemokines belonging to the CXC family could play an important role in the etiology of tendon xanthoma (TX), with CXCL3 being a possible biological marker of onset and development of TX PMID: 19448742
overexpression of CXCL13 in the intestine during inflammatory conditions favors mobilization of B cells and of LTi and NK cells with immunomodulatory and reparative functions. PMID: 19741597

Hide All

Subcellular Location

Secreted.

Protein Families

Intercrine alpha (chemokine CxC) family

Database Links

HGNC: 4604

OMIM: 139111

KEGG: hsa:2921

STRING: 9606.ENSP00000296026

UniGene: Hs.89690

Code	CSB-EP006249HU
Abbreviation	Recombinant Human CXCL3 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human C-X-C motif chemokine 3 (CXCL3)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage