Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Code | CSB-AP003551HU |
Size |
InquiryPurchase it in Cusabio online store (only available for customers from the US) |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is typically 80 ng/mL. |
Target Names | CXCL3 |
Uniprot No. | P19876 |
Research Area | Immunology |
Alternative Names | C-X-C motif chemokine 3; C-X-C motif chemokine ligand 3; Chemokine (C X C motif) ligand 3; Chemokine (CXC motif) ligand 3; Cinc 2; CINC 2b; Cinc2; CINC2b; CXCL 3; Cxcl3; CXCL3_HUMAN; Cytokine induced neutrophil chemoattractant 2; Dcip1; Dendritic cell inflammatory protein 1; Gm1960; GRO protein gamma; GRO-gamma; GRO-gamma(1-73); GRO-gamma(5-73); GRO3; GRO3 oncogene; GROG; Growth regulated protein gamma; Growth-regulated protein gamma; Macrophage inflammatory protein 2 beta precursor ; Macrophage inflammatory protein 2-beta; Melanoma growth stimulatory activity gamma; Member 3; MGSA gamma; MIP 2b; MIP2-beta; MIP2B; SCYB3; Small inducible cytokine subfamily B |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 35-107aa |
Complete Sequence | ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN |
Mol. Weight | 10.1 kDa |
Protein Length | Full Length of Mature Protein |
Tag Info |
N-terminal 6xHis-tagged |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Ligand for CXCR2. Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes.
|
Gene References into Functions |
|
Subcellular Location | Secreted. |
Protein Families | Intercrine alpha (chemokine CxC) family |
Database Links |
HGNC: 4604 OMIM: 139111 KEGG: hsa:2921 STRING: 9606.ENSP00000296026 UniGene: Hs.89690 |