Recombinant Human C-X-C motif chemokine 3(CXCL3)

In Stock
Code CSB-AP003551HU
Product Type Chemokine
Size US$137
Uniprot No. P19876
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias C-X-C Motif Chemokine 3; GRO-Gamma (1-73); Growth-Regulated Protein Gamma; GRO-Gamma; Macrophage Inflammatory Protein 2-Beta; MIP2-Beta; GRO-Gamma (5-73); CXCL3; GRO3; GROG; SCYB3
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is typically 80 ng/mL.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Research Area Immunology
Source E.coli
Gene Names CXCL3
Expression Region 35-107aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 10.1 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Ligand for CXCR2 (By similarity). Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes.
Subcellular Location Secreted
Protein Families Intercrine alpha (chemokine CxC) family
Database Links

HGNC: 4604

OMIM: 139111

KEGG: hsa:2921

STRING: 9606.ENSP00000296026

UniGene: Hs.89690

Pathway Chemokine signaling pathway
TNF signaling pathway
IL-17 signaling pathway
NOD-like receptor signaling pathway

Related Products

CXCL3 Antibodies

CXCL3 Antibodies for Homo sapiens (Human)

CXCL3 Proteins

CXCL3 Proteins for Homo sapiens (Human)

CXCL3 ELISA Kit

CXCL3 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.