Recombinant Human Calcineurin subunit B type 2 (PPP3R2)

Code CSB-EP856978HU
Abbreviation Recombinant Human PPP3R2 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Calcineurin B like protein; Calcineurin B type II (19kDa); Calcineurin B type II; Calcineurin B-like protein; Calcineurin BII; Calcineurin subunit B isoform 2; Calcineurin subunit B type 2; CANB2_HUMAN; CBLP; CBLP like; CNBII; PPP3R1-like; Ppp3r2; PPP3RL; Protein phosphatase 2B regulatory subunit 2; Protein phosphatase 3 (formerly 2B) regulatory subunit B (19kD) beta isoform (calcineurin B type II); Protein phosphatase 3 (formerly 2B) regulatory subunit B beta isoform; Protein phosphatase 3 (formerly 2B); regulatory subunit B; 19kDa; beta isoform (calcineurin B; type II); Protein phosphatase 3 regulatory subunit B (19kD) beta isoform (calcineurin B type II); Protein phosphatase 3 regulatory subunit B (calcineurin B) like; Protein phosphatase 3 regulatory subunit B beta; Protein phosphatase 3 regulatory subunit B beta isoform
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-170aa
Target Protein Sequence
GNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.4kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.
Gene References into Functions
  1. PPP3RL gene localizes to human chromosome 9q22 and transcripts of PPP3RL gene are specifically expressed in the testis. PMID: 15865209
  2. cyclosporin and tacrolimus exert significantly different effects on calcineurin activity in renal transplant patients with stable, well-functioning grafts PMID: 16961774
  3. calcineurin B potentiates the activation of procaspase-3 by accelerating its proteolytic maturation PMID: 17324936
  4. Here, we report that Cabin1 has additional CN binding domain in its 701-900 amino acid residues. PMID: 17531200
  5. Data suggest that calcineurin may regulate the kinase activity of CDK4 in a cell cycle-dependent manner and may be an important component of the negative regulation of CDK4. PMID: 17892862

Show More

Hide All

Protein Families
Calcineurin regulatory subunit family
Tissue Specificity
Testis-specific.
Database Links

HGNC: 9318

OMIM: 613821

KEGG: hsa:5535

STRING: 9606.ENSP00000363939

UniGene: Hs.151167

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*