Recombinant Human E-selectin (SELE), partial

Code CSB-MP020975HU1
Abbreviation Recombinant Human SELE protein, partial
MSDS
Size $98
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Alternative Names
CD62 antigen-like family member E;Endothelial leukocyte adhesion molecule 1;Leukocyte-endothelial cell adhesion molecule 2
Source
Mammalian cell
Expression Region
22-556aa
Target Protein Sequence
WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
60.0 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with SELPLG/PSGL1. May have a role in capillary morphogenesis.
Gene References into Functions
  1. Results highlight novel mechanisms by which p38 downregulates the expression of E-selectin through miR-146a and miR-31 following inflammatory stimuli associated to cancer progression. PMID: 29402939
  2. Levels of E and P selectin showed positive correlation with the length of stay. PMID: 29517629
  3. Our study shows a significant association of E-selectin gene polymorphism(Leu554Phe) with essential hypertension. PMID: 29178542
  4. The highest levels of sL- and sE-selectin were observed in colorectal patients with lymph node metastasis. PMID: 27775438
  5. Circulating CD62E(+) microparticle levels are abnormal in subjects with pre-diabetes. PMID: 28927403
  6. sVCAM-1 reflects xerostomia in primary Sjogren's syndrome. sICAM-1 and sE-selectin may be additional parameters of secondary Sjogren's syndrome activity. PMID: 29068581
  7. Neutrophil rolling over E-selectin at precise shear stress transmits tension and catch-bond formation with L-selectin via sLe(x), resulting in focal clusters that deliver a distinct signal to upshift beta2-integrins to a high-affinity state. Rivipansel effectively blocked formation of selectin catch-bonds, revealing a novel mechanotransduction circuit PMID: 28811304
  8. E-selectin-dependent rolling promotes adhesion to HA by both physically slowing cells and enabling them to position proximal to the surface, thereby increasing the on rate of adhesion. PMID: 28765175
  9. High E-selectin expression is associated with breast cancer metastasis. PMID: 27220365
  10. his study shows that two adhesion molecules, shed as soluble forms, are elevated during the acute phase of leptospirosis: E-selectin and s-ICAM1. These molecules may interfere with the process of immune cell recruitment to clear Leptospira at tissue levels. PMID: 28686648
  11. ELAM-1 upregulation may promote disorder in adhesion, and migration of the cells leading to the endometriosis disorder. PMID: 27433816
  12. Elevated endothelium-related mediators (vWF, E-selectin and EPCR) appear to participate in the development of pancreatic necrosis and may be a potential indicator of overall prognosis. PMID: 28007459
  13. interplay between flow-dependent on-rate and off-rate of E-selectin-ligand bonds determine flow-enhanced cell rolling stability PMID: 27558713
  14. High SELE expression is associated with Inflamed Atherosclerotic Plaque. PMID: 27237221
  15. In this study, we addressed this question by analysing sLex expression together with two glycoproteins (BST-2 and LGALS3BP), shown to interact with E-selectin in a carbohydrate-dependent manner, in a cohort of 249 invasive breast cancers PMID: 27176937
  16. SELE expression is significantly upregulated in human masticatory mucosa during wound healing PMID: 28005267
  17. E-selectin concentrations in this study were associated with hyperglycemia, possibly reflecting early endothelial damage. E-selectin was not useful to assess carotid intima-media thickness, a marker of subclinical atherosclerosis, which appeared to be determined by aging and male gender. PMID: 27141013
  18. Plasma E-selectin is overexpressed in pediatric patients with mycoplasma pneumoniae pneumonia and myocardial injury. PMID: 26843511
  19. The significant presence of CLA+ T cells and E-selectin (CD62E) expressions in the OLPG suggests their involvement in the etiopathogenesis of oral lichen planus ; however, only a weak correlation between CLA+ T cells and E-selectin was observed. PMID: 26332489
  20. BD patients have a lower expression of ICAM-1, VCAM-1, and E-selectin in their tumor tissues. BD-HDL facilitates the adhesion of tumor cells to vascular endothelium by upregulating the expression of ICAM-1 and VCAM-1, thereby promoting the initial progression of breast cancer metastasis PMID: 26872904
  21. The E-selectin S149R polymorphisms is associated with the oncogenesis of breast cancer. PMID: 26828984
  22. Neisseria meningitidis caused a high level of E-selectin expression elicited by the activity of phosphorylated ATF2 transcription factor on the E-selectin promoter. PMID: 26153406
  23. E-selectin is more effective than cTnI in diagnosing myocardial injury in children. PMID: 26617843
  24. Inhibition of E-selectin expression allows an anti-tumoral effect on sLex-expressing hepatocellular carcinoma tumors in vivo PMID: 26988221
  25. Glycosphingolipids likely contribute to human myeloid cell adhesion to E-selectin under fluid shear, particularly the transition of rolling cells to firm arrest. PMID: 26868209
  26. Data show that both mucin16 (MUC16) and podocalyxin (PODXL)-E-selectin-mediated interactions are mechanically stronger than like L-selectin interactions at the single-molecule level. PMID: 26329844
  27. These findings provide consistent evidence that A516C and G98T polymorphisms of the SELE gene may be associated with increased susceptibility of coronary artery disease. PMID: 26937892
  28. Glaucomatous MYOC mutations activate the IL-1beta/NF-kappaB inflammatory stress response and the glaucoma marker SELE in trabecular meshwork cells. PMID: 26396484
  29. P. gingivalis was shown to activate NOD1, NOD2, and TLR2 expression, resulting in increased E-selectin expression in endothelial cells; direct inhibition of NF-kappaB and P38 MAPK significantly attenuated E-selectin expression induced by P. gingivalis in endothelial cells PMID: 25939768
  30. The number of E-selectin-positive cells was significantly higher in the tuberculoid form than in the lepromatous form of leprosy skin lesions. PMID: 26051909
  31. Gene-based study revealed significant associations of the SELE gene with Blood Pressure phenotypes for the first time among the Chinese Han population. PMID: 25424718
  32. This study showed that no significant differences in F206L Polymorphism of l-Selectin Between the Patients with Bronchial Asthma and Control. PMID: 24798295
  33. Blood ESEL was higher in pregnant women with preeclampsia, and non-pregnant women with a history of preeclampsia than women without preeclampsia or a history of preeclampsia. PMID: 26116870
  34. The findings suggest that C allele carriers of the SELE gene polymorphism (A561C) might be predisposed to EH in the Chinese population. PMID: 25171839
  35. E-selectin promoter was highly and specifically acetylated in the confluent monolayer after tumor necrosis factor alpha activation. PMID: 24690766
  36. E-selectin interactions with glycoprotein ligands (CD44/hematopoietic cell E-/L-selectin ligand and PSGL-1) mediate the initial capturing of cells out of flow. PMID: 26124272
  37. SELE rs3917412 and MTHFR rs1801133 SNPs could serve as pharmacogenetic predictors of tumor recurrence in patients with early-stage colon cancer treated with oxaliplatin-based adjuvant chemotherapy PMID: 24980946
  38. sE-selectin and the LDL were the most important predictors of late arteriovenous fistula stenosis PMID: 24627030
  39. The C allele of E-selectin A561C gene polymorphism might increase the essential hypertension (EH) risk in Asian population, whereas the T allele of E-selectin C1839T gene polymorphism might decrease the EH risk. [meta-analysis] PMID: 25003340
  40. Bereaved respondents had higher levels of inflammatory biomarkers IL-6 and sE-selectin, but not CRP and sICAM-I than the non-bereaved. PMID: 24266503
  41. SE-selectin and PAPPA may contribute to future cardiovascular events in women post preeclampsia; in contrast, ApoB may be involved in a protective mechanism PMID: 25238218
  42. the haplotype TCC in the Han hypertensive patients and the haplotype GGC in the Mongolian patients had independent effects in increasing the risk for essential hypertension; multiple single-nucleotide polymorphisms in combination in SELE may confer a risk of hypertension. PMID: 25748737
  43. Found the AC genotype to be a significant risk factor for hemorrhagic stroke and we also found significant differences in AC genotype and C allele among hemorrhagic stroke and ischemic stroke patients. PMID: 25168603
  44. The rs5361 E-selectin gene polymorphism is not a susceptibility marker for ACS in Western Mexico population. However, sE-selectin may be a biological marker of ACS. PMID: 25147432
  45. ST3Gal-4 is the primary sialyltransferase regulating the synthesis of E-, P-, and L-selectin ligands on human myeloid leukocytes PMID: 25498912
  46. an upregulation of E-selectin and the associated influx of neutrophils may play a significant role in the resolution of inflammation as well as for the pathophysiology of nasal polyps of Caucasian chronic rhinosinusitis patients. PMID: 24995349
  47. in human aortic and vein endothelial cells, expression and release of ICAM-1 and E-selectin were induced by treatment with conditioned medium collected from Pal-stimulated pTHP-1 cells PMID: 25201247
  48. CD62E was found to be a new biomarker for patients with hypertension and hyperlipidemia. PMID: 24820735
  49. High E-Selectin expression is associated with small cell lung cancer metastasis. PMID: 24699516
  50. there was association between the E-selectin S128R polymorphism and the risk of cancer. PMID: 24815478

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Selectin/LECAM family
Database Links

HGNC: 10718

OMIM: 131210

KEGG: hsa:6401

STRING: 9606.ENSP00000331736

UniGene: Hs.82848

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*