Recombinant Human E-selectin(SELE)

Code CSB-CF020975HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P16581
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESDGSYQKPSYIL
Source in vitro E.coli expression system
Gene Names SELE
Protein Names Recommended name: E-selectin Alternative name(s): CD62 antigen-like family member E Endothelial leukocyte adhesion molecule 1 Short name= ELAM-1 Leukocyte-endothelial cell adhesion molecule 2 Short name= LECAM2 CD_antigen= CD62E
Expression Region 22-610
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with SELPLG/PSGL1. May have a role in capillary morphogenesis.
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Selectin/LECAM family
Database Links

HGNC: 10718

OMIM: 131210

KEGG: hsa:6401

STRING: 9606.ENSP00000331736

UniGene: Hs.82848

Pathway TNF signaling pathway
AGE-RAGE signaling pathway in diabetic complications

Related Products

SELE Antibodies

SELE Antibodies for Homo sapiens (Human)

SELE Proteins

SELE Proteins for Homo sapiens (Human)

SELE ELISA Kit

SELE ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.