Recombinant Human G2/mitotic-specific cyclin-B1 (CCNB1)

In Stock
Code CSB-EP004806HUa0
Abbreviation Recombinant Human CCNB1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-433aa
Target Protein Sequence
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
52.4 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Essential for the control of the cell cycle at the G2/M (mitosis) transition.
Gene References into Functions
  1. FOXM1 promotes proliferation in human hepatocellular carcinoma cells by transcriptional activation of CCNB1. PMID: 29705704
  2. SNAP23 suppressed progression of cervical cancer and induced cell cycle G2/M arrest via upregulating p21(cip1) and downregulating CyclinB1 PMID: 29908998
  3. Defective cyclin B1 induction by T-DM1 mediates acquired resistance in HER2-positive breast cancer cells. PMID: 28821558
  4. Up-regulation of CCNB1 could be an indicator for invasiveness of pituitary adenomas.Up-regulation of CCNB1 could be an indicator for invasiveness of pituitary adenomas. PMID: 28601573
  5. We identified the known APC/C regulator Cdh1 and the F-box protein Fbxl15 as specific modulators of N-cyclin B1-luciferase steady-state levels and turnover. Collectively, our studies suggest that analyzing the steady-state levels of luciferase fusion proteins in parallel facilitates identification of specific regulators of protein turnover. PMID: 28296622
  6. Overexpression of cyclin B1 is correlated with poor survival in most solid tumors, which suggests that the expression status of cyclin B1 is a significant prognostic parameter in solid tumors. [review] PMID: 27903976
  7. CDK9, in addition to CDK1, has roles in mediating the growth inhibitory effect of dinaciclib on cyclin B1 in triple negative breast cancer PMID: 27486754
  8. Data show that Islet-1 (ISL1) activated the expression of cyclin B1 (CCNB1), cyclin B2 (CCNB2) and c-myc (c-MYC) genes by binding to the conserved binding sites on their promoters or enhancers. PMID: 27183908
  9. XIAP is stable during mitotic arrest, but its function is controlled through phosphorylation by the mitotic kinase CDK1-cyclin-B1 at S40. PMID: 27927753
  10. ZIC5 is highly upregulated in non-small cell lung cancer tumor tissues and may act as an oncogene by influencing CCNB1 and CDK1 complex expression PMID: 27663664
  11. Knockdown of DRG2 elicited down-regulation of the major mitotic promoting factor, the cyclin B1/Cdk1 complex. PMID: 27669826
  12. Mitochondrial Ribosomal Protein L10 regulates cyclin B1/Cdk1 (cyclin-dependent kinase 1) activity and mitochondrial protein synthesis in mammalian cells PMID: 27726420
  13. Changes in expression and localization of cyclin B1 may constitute a part of the mechanism responsible for resistance of HL-60 cells to etoposide. PMID: 27297620
  14. Data suggest that long non-coding RNA ZFAS1 may function as oncogene via destabilization of tumor suppressor protein p53 (p53) and through cyclin-dependent kinase 1 (CDK1)/cyclin B1 complex leading to cell cycle progression and inhibition of apoptosis. PMID: 26506418
  15. exposing renal carcinoma cells to amygdalin inhibited cell cycle progression and tumor cell growth by impairing cdk1 and cyclin B expression PMID: 26709398
  16. Sodium butyrate accelerates 3' UTR-dependent cyclin B1 decay by enhancing the binding of tristetraprolin to the 3' untranslated region of cyclin B1. PMID: 26555753
  17. CDK1-Cyclin B1 activates RNMT, coordinating mRNA cap methylation with G1 phase transcription. PMID: 26942677
  18. Our results demonstrate for the first time that the SYSADOA diacerein decreased the viability of human chondrosarcoma cells and induces G2/M cell cycle arrest by CDK1/cyclin B1 down-regulation. PMID: 26555773
  19. CCNB1 is target of miRNA-410 since its overexpression reduces CCNB1 at protein and mRNA levels. PMID: 26125663
  20. Germ cell tumors consistently overexpressed cyclin B1 independently of their responsiveness to chemotherapy or the presence of p53 mutations. Cyclin B1 was overexpressed by GCT cell lines carrying functional p53. PMID: 25982682
  21. The authors postulate that the mechanism of cytomegalovirus pUL97-human cyclin B1 interaction is determined by an active pUL97 kinase domain. PMID: 26270673
  22. Stereospecific phosphorylation of only the Ser-trans-Pro peptide by Cdk1-cyclin B1 PMID: 25603287
  23. Pharmacological inhibition or siRNA-mediated knockdown of cdk1/CCNB1 induced proliferation arrest independent of MYCN status in neuroblastoma cells. PMID: 26029996
  24. Expression of CDK1 Tyr15, pCDK1 Thr161, Cyclin B1 (total) and pCyclin B1 Ser126 in vulvar squamous cell carcinoma and their relations with clinicopatological features and prognosis. PMID: 25849598
  25. BUB1B expression was highly correlated to CDC20 and CCNB1 expression in multiple myeloma cells, leading to increased cell proliferation. PMID: 25698537
  26. Proximity ligation assay demonstrate proximity between S100A4 and cyclin B1 in vitro, while confocal microscopy showed S100A4 to localize to areas corresponding to centrosomes in mitotic cells prior to chromosome segregation. PMID: 26349943
  27. Cyclin B1 could suppress the invasion and metastasis of colorectal cancer cells through regulating E-cadherin expression, which enables the development of potential intervention strategies for colorectal cancer. PMID: 25962181
  28. CCNB1 is a biomarker for the prognosis of ER+ breast cancer and monitoring of hormone therapy efficacy PMID: 25044212
  29. that CCNB1 contained many CD4 T cell epitopes, which are differentially recognized by pre-existing naive and memory CD4 T cells. PMID: 26136431
  30. CCNB1 activation is associated with recurrence in non-muscle-invasive bladder cancer. PMID: 24714775
  31. PKCa and Cyclin B1 are linked in a DAG-dependent mechanism that regulates cell cycle progression PMID: 25362646
  32. Complete removal of cyclin B1 is essential to prevent the return of the spindle checkpoint following sister chromatid disjunction. PMID: 25483188
  33. Data show that inappropriate overexpression of cyclin B1 causes non-specific cell death. PMID: 25415322
  34. Cyclin B1 marks the restriction point for permanent cell cycle exit in G2 phase. PMID: 25486360
  35. CCNB1 is activated by Chk1, exerts its oncogenic role in colorectal cancer cells, and may play a key role in the development of a novel therapeutic approach against colorectal cancer. PMID: 24971465
  36. Stable association of Cdk1-cyclin B1 with phosphorylated separase counteracts this tendency and stabilizes separase in an inhibited yet activatable state PMID: 25659430
  37. the results were indicative that cyclin B may hold independent prognostic significance, but further studies are required to assess this. PMID: 25315186
  38. that MAD2B may play an important role in high glucose-mediated podocyte injury of diabetic nephropathy via modulation of Cdh1, cyclin B1, and Skp2 expression PMID: 25651564
  39. Expression of cycle marker cyclin B1 differs between benign and malignant papillary breast lesions. PMID: 25501285
  40. Phosphorylated Akt plays an important role in regulating the expression level of cyclin B1 by interacting with AR and increasing the transcriptional activity of AR. PMID: 24574517
  41. Cyclin B1 expression was studied immunohistochemically in specimens from 241 patients with pancreatic cancer and was correlated with clinicopathological features and patient survival. PMID: 25106528
  42. Cyclin B1 overexpression is associated with medullary thyroid carcinoma. PMID: 24488334
  43. study indicates that genetic polymorphisms of CCNB1 and CDK1 are related to BC susceptibility, progression, and survival in Chinese Han women. PMID: 24386390
  44. Parvovirus-induced depletion of cyclin B1 prevents mitotic entry of infected cells. PMID: 24415942
  45. our data suggest that the non-canonical Hh pathway mediated through ptch1 and cyclin B1 is involved in the pathogenesis of NBCCS-associated KCOTs. PMID: 24840883
  46. Allele-dependent transcriptional regulation of CCNB1 associated with the SNPs rs350099, rs350104, and rs164390 affects ISR risk through differential recruitment of NF-Y, AP-1, and SP1. PMID: 24395923
  47. Cyclin B1 and cyclin B2 are interchangeable for ability to promote G2 and M transition in HeLa cells. PMID: 24324638
  48. Our results indicated that CDB(cyclin B destruction box )-fused fluorescent protein can be used to examine the slight gene regulations in the reporter gene system PMID: 24416725
  49. The cyclin B 3'UTR was not sufficient to enhance cyclin B synthesis. PMID: 24058555
  50. Cyclin B1/Cdk1-mediated phosphorylation of mitochondrial substrates allows cells to sense and respond to increased energy demand for G2/M transition and, subsequently, to upregulate mitochondrial respiration for successful cell-cycle progression. PMID: 24746669

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Protein Families
Cyclin family, Cyclin AB subfamily
Database Links

HGNC: 1579

OMIM: 123836

KEGG: hsa:891

STRING: 9606.ENSP00000256442

UniGene: Hs.23960

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*