Recombinant Human G2/mitotic-specific cyclin-B1(CCNB1)

Code CSB-YP004806HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P14635
Relevance Essential for the control of the cell cycle at the G2/M (mitosis) transition.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias CCNB
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
Research Area Cell Biology
Source Yeast
Gene Names CCNB1
Protein Names Recommended name: G2/mitotic-specific cyclin-B1
Expression Region 1-433aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 50.3kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Essential for the control of the cell cycle at the G2/M (mitosis) transition.
Subcellular Location Cytoplasm, Nucleus, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome
Protein Families Cyclin family, Cyclin AB subfamily
Database Links

HGNC: 1579

OMIM: 123836

KEGG: hsa:891

STRING: 9606.ENSP00000256442

UniGene: Hs.23960

Pathway p53 signaling pathway
Cell cycle
Cellular senescence
FoxO signaling pathway

Related Products

CCNB1 Antibodies

CCNB1 Antibodies for Homo sapiens (Human)

CCNB1 Antibodies for

CCNB1 Proteins

CCNB1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.