Recombinant Human G2/mitotic-specific cyclin-B1(CCNB1)

Code CSB-YP004806HU
Size US$1298
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names CCNB1
Uniprot No. P14635
Research Area Cell Biology
Alternative Names CCNB 1; CCNB; ccnb1; CCNB1_HUMAN; Cyclin B1; G2 mitotic specific cyclin B1 ; G2/mitotic-specific cyclin-B1
Species Homo sapiens (Human)
Source Yeast
Expression Region 1-433aa
Target Protein Sequence MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 50.3kDa
Protein Length Full Length
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Essential for the control of the cell cycle at the G2/M (mitosis) transition.
Gene References into Functions
  1. FOXM1 promotes proliferation in human hepatocellular carcinoma cells by transcriptional activation of CCNB1. PMID: 29705704
  2. SNAP23 suppressed progression of cervical cancer and induced cell cycle G2/M arrest via upregulating p21(cip1) and downregulating CyclinB1 PMID: 29908998
  3. Defective cyclin B1 induction by T-DM1 mediates acquired resistance in HER2-positive breast cancer cells. PMID: 28821558
  4. Up-regulation of CCNB1 could be an indicator for invasiveness of pituitary adenomas.Up-regulation of CCNB1 could be an indicator for invasiveness of pituitary adenomas. PMID: 28601573
  5. We identified the known APC/C regulator Cdh1 and the F-box protein Fbxl15 as specific modulators of N-cyclin B1-luciferase steady-state levels and turnover. Collectively, our studies suggest that analyzing the steady-state levels of luciferase fusion proteins in parallel facilitates identification of specific regulators of protein turnover. PMID: 28296622
  6. Overexpression of cyclin B1 is correlated with poor survival in most solid tumors, which suggests that the expression status of cyclin B1 is a significant prognostic parameter in solid tumors. [review] PMID: 27903976
  7. CDK9, in addition to CDK1, has roles in mediating the growth inhibitory effect of dinaciclib on cyclin B1 in triple negative breast cancer PMID: 27486754
  8. Data show that Islet-1 (ISL1) activated the expression of cyclin B1 (CCNB1), cyclin B2 (CCNB2) and c-myc (c-MYC) genes by binding to the conserved binding sites on their promoters or enhancers. PMID: 27183908
  9. XIAP is stable during mitotic arrest, but its function is controlled through phosphorylation by the mitotic kinase CDK1-cyclin-B1 at S40. PMID: 27927753
  10. ZIC5 is highly upregulated in non-small cell lung cancer tumor tissues and may act as an oncogene by influencing CCNB1 and CDK1 complex expression PMID: 27663664
  11. Knockdown of DRG2 elicited down-regulation of the major mitotic promoting factor, the cyclin B1/Cdk1 complex. PMID: 27669826
  12. Mitochondrial Ribosomal Protein L10 regulates cyclin B1/Cdk1 (cyclin-dependent kinase 1) activity and mitochondrial protein synthesis in mammalian cells PMID: 27726420
  13. Changes in expression and localization of cyclin B1 may constitute a part of the mechanism responsible for resistance of HL-60 cells to etoposide. PMID: 27297620
  14. Data suggest that long non-coding RNA ZFAS1 may function as oncogene via destabilization of tumor suppressor protein p53 (p53) and through cyclin-dependent kinase 1 (CDK1)/cyclin B1 complex leading to cell cycle progression and inhibition of apoptosis. PMID: 26506418
  15. exposing renal carcinoma cells to amygdalin inhibited cell cycle progression and tumor cell growth by impairing cdk1 and cyclin B expression PMID: 26709398
  16. Sodium butyrate accelerates 3' UTR-dependent cyclin B1 decay by enhancing the binding of tristetraprolin to the 3' untranslated region of cyclin B1. PMID: 26555753
  17. CDK1-Cyclin B1 activates RNMT, coordinating mRNA cap methylation with G1 phase transcription. PMID: 26942677
  18. Our results demonstrate for the first time that the SYSADOA diacerein decreased the viability of human chondrosarcoma cells and induces G2/M cell cycle arrest by CDK1/cyclin B1 down-regulation. PMID: 26555773
  19. CCNB1 is target of miRNA-410 since its overexpression reduces CCNB1 at protein and mRNA levels. PMID: 26125663
  20. Germ cell tumors consistently overexpressed cyclin B1 independently of their responsiveness to chemotherapy or the presence of p53 mutations. Cyclin B1 was overexpressed by GCT cell lines carrying functional p53. PMID: 25982682
  21. The authors postulate that the mechanism of cytomegalovirus pUL97-human cyclin B1 interaction is determined by an active pUL97 kinase domain. PMID: 26270673
  22. Stereospecific phosphorylation of only the Ser-trans-Pro peptide by Cdk1-cyclin B1 PMID: 25603287
  23. Pharmacological inhibition or siRNA-mediated knockdown of cdk1/CCNB1 induced proliferation arrest independent of MYCN status in neuroblastoma cells. PMID: 26029996
  24. Expression of CDK1 Tyr15, pCDK1 Thr161, Cyclin B1 (total) and pCyclin B1 Ser126 in vulvar squamous cell carcinoma and their relations with clinicopatological features and prognosis. PMID: 25849598
  25. BUB1B expression was highly correlated to CDC20 and CCNB1 expression in multiple myeloma cells, leading to increased cell proliferation. PMID: 25698537
  26. Proximity ligation assay demonstrate proximity between S100A4 and cyclin B1 in vitro, while confocal microscopy showed S100A4 to localize to areas corresponding to centrosomes in mitotic cells prior to chromosome segregation. PMID: 26349943
  27. Cyclin B1 could suppress the invasion and metastasis of colorectal cancer cells through regulating E-cadherin expression, which enables the development of potential intervention strategies for colorectal cancer. PMID: 25962181
  28. CCNB1 is a biomarker for the prognosis of ER+ breast cancer and monitoring of hormone therapy efficacy PMID: 25044212
  29. that CCNB1 contained many CD4 T cell epitopes, which are differentially recognized by pre-existing naive and memory CD4 T cells. PMID: 26136431
  30. CCNB1 activation is associated with recurrence in non-muscle-invasive bladder cancer. PMID: 24714775
  31. PKCa and Cyclin B1 are linked in a DAG-dependent mechanism that regulates cell cycle progression PMID: 25362646
  32. Complete removal of cyclin B1 is essential to prevent the return of the spindle checkpoint following sister chromatid disjunction. PMID: 25483188
  33. Data show that inappropriate overexpression of cyclin B1 causes non-specific cell death. PMID: 25415322
  34. Cyclin B1 marks the restriction point for permanent cell cycle exit in G2 phase. PMID: 25486360
  35. CCNB1 is activated by Chk1, exerts its oncogenic role in colorectal cancer cells, and may play a key role in the development of a novel therapeutic approach against colorectal cancer. PMID: 24971465
  36. Stable association of Cdk1-cyclin B1 with phosphorylated separase counteracts this tendency and stabilizes separase in an inhibited yet activatable state PMID: 25659430
  37. the results were indicative that cyclin B may hold independent prognostic significance, but further studies are required to assess this. PMID: 25315186
  38. that MAD2B may play an important role in high glucose-mediated podocyte injury of diabetic nephropathy via modulation of Cdh1, cyclin B1, and Skp2 expression PMID: 25651564
  39. Expression of cycle marker cyclin B1 differs between benign and malignant papillary breast lesions. PMID: 25501285
  40. Phosphorylated Akt plays an important role in regulating the expression level of cyclin B1 by interacting with AR and increasing the transcriptional activity of AR. PMID: 24574517
  41. Cyclin B1 expression was studied immunohistochemically in specimens from 241 patients with pancreatic cancer and was correlated with clinicopathological features and patient survival. PMID: 25106528
  42. Cyclin B1 overexpression is associated with medullary thyroid carcinoma. PMID: 24488334
  43. study indicates that genetic polymorphisms of CCNB1 and CDK1 are related to BC susceptibility, progression, and survival in Chinese Han women. PMID: 24386390
  44. Parvovirus-induced depletion of cyclin B1 prevents mitotic entry of infected cells. PMID: 24415942
  45. our data suggest that the non-canonical Hh pathway mediated through ptch1 and cyclin B1 is involved in the pathogenesis of NBCCS-associated KCOTs. PMID: 24840883
  46. Allele-dependent transcriptional regulation of CCNB1 associated with the SNPs rs350099, rs350104, and rs164390 affects ISR risk through differential recruitment of NF-Y, AP-1, and SP1. PMID: 24395923
  47. Cyclin B1 and cyclin B2 are interchangeable for ability to promote G2 and M transition in HeLa cells. PMID: 24324638
  48. Our results indicated that CDB(cyclin B destruction box )-fused fluorescent protein can be used to examine the slight gene regulations in the reporter gene system PMID: 24416725
  49. The cyclin B 3'UTR was not sufficient to enhance cyclin B synthesis. PMID: 24058555
  50. Cyclin B1/Cdk1-mediated phosphorylation of mitochondrial substrates allows cells to sense and respond to increased energy demand for G2/M transition and, subsequently, to upregulate mitochondrial respiration for successful cell-cycle progression. PMID: 24746669
  51. miR-379 is a novel regulator of Cyclin B1 expression, with significant loss of the miRNA observed in breast tumours. PMID: 23874748
  52. cdc2/cyclin B-mediated EBP50 phosphorylation may play a role in the regulation of various cell functions by affecting actin cytoskeleton reorganization. PMID: 23775624
  53. The up-regulated cyclin B1/Cdc2 complex not only mediates prometaphase arrest. PMID: 22949227
  54. Findings implicate phosphorylation of eIF4G1(Ser1232) by Cdk1:cyclin B and its inhibitory effects on eIF4A helicase activity in the mitotic translation initiation shift. PMID: 24248602
  55. We further detected that reduced level of GRK2 induced a small cell cycle arrest at G2/M phase by enhancing the expression of cyclin A, B1, and E PMID: 23460259
  56. We find that a short, evolutionarily conserved N-terminal motif is required for cyclin B1 to localize to mitotic chromosomes. PMID: 23505570
  57. Elevated cyclin B1 expression attenuates the apoptosis induced by cisplatin or paclitaxel in human esophageal squamous cell carcinoma cells. PMID: 23114644
  58. Silencing beta-catenin gene may induce changes of cell cycle and in cyclin B1 and cyclin C protein expression. PMID: 22024040
  59. treatment of human cancer cells with 2-methoxyestradiol causes up-regulation of cyclin B1 and Cdc2, which then mediate the induction of mitotic prometaphase arrest. PMID: 22580043
  60. p53 dimers associate with the head-to-tail element to repress cyclin B transcription PMID: 22905155
  61. CDK1/cyclin B1 is the major kinase that phosphorylates Sp1. PMID: 22266860
  62. These results revealed that cyclin B1 and Sec62 may be candidate biomarkers and potential therapeutic targets for HBV-related HCC recurrence after surgery. PMID: 22682366
  63. The Changes in cyclin B1 may be strictly related to its different regulation at mitotic catastrophe and senescence programs. PMID: 22532137
  64. Treatment with myricetin led to G2/M cell cycle arrest in T24 bladder cancer cells by downregulation of Cyclin B1 and cyclin-dependent kinase cdc2. PMID: 22482362
  65. Cdk1/cyclin B1-dependent hyper-phosphorylation of Bim during prolonged mitotic arrest is an important cell death signal. PMID: 22071694
  66. Estrogen receptor beta causes a G2 cell cycle arrest by inactivating CDK1 through the repression of cyclin B1 and stimulation of GADD45A and BTG2 expression. PMID: 21120602
  67. Tip60 forms a ternary complex with Plk1 and cyclin B1 and acetylates Plk1 but not cyclin B1. PMID: 22391203
  68. Study used chemical biology approaches and live-cell microscopy to show that nuclear Cdk1-cyclin B1 promotes the translocation of Cdk1-cyclin B1 to the nucleus. PMID: 22726437
  69. The switch between E2F1 and E2F4 at the E2F binding site of the cyclin B1 promoter coincides with an androgen-dependent interaction between AR and E2F1 as well as the cytoplasmic-to-nuclear translocation of E2F4. PMID: 22508987
  70. Phosphorylation of AIB1 at mitosis is regulated by CDK1/CYCLIN B PMID: 22163316
  71. Mitotic entry is enhanced through the direct upregulation of cyclin B1 expression effectuated by STOX1A. PMID: 22253775
  72. This suggests that expression of CCNB1 might be a potent tool for predicting the clinical prognosis of meningioma patients. PMID: 22137483
  73. Data show that anaphase-promoting complex or cyclosome (APC/C)-mediated multiple monoubiquitylation targeting cyclin B1 for degradation. PMID: 22286100
  74. Tuberin binding to cyclin B1 regulates mitotic onset. PMID: 21900748
  75. the activating phosphorylation of cyclin B1-CDK1 was tightly coupled to its T14 phosphorylation, but not Y15 phosphorylation PMID: 21900495
  76. Cdk1/cyclin B plays a key role in mitotic arrest-induced apoptosis via Mcl-1 phosphorylation, promoting its degradation and subsequently releasing Bak from sequestration. PMID: 22024133
  77. Data show that knocking down cdk1 or cyclin B distinctly blocked the growth activity of PC3(res). PMID: 21925791
  78. High cyclin B1 expression significantly correlated with the high tumor grade, but not with gender, tumor size, nodal status, local tumor recurrence or p53 expression. PMID: 21965721
  79. overexpression of cyclin B1 could play an important role in the evolution of classical Hodgkin lymphoma PMID: 21174181
  80. Data indicate that isochaihulactone induces G2/M cell cycle arrest via downregulation of cyclin B1 and cdc2, and induces cellular death by upregulation of NAG-1 via JNK activation in LNCaP cells. PMID: 21504622
  81. Taken together, these results suggest that Vif impairs mitotic entry by interfering with Cdk1-CyclinB1 activation. PMID: 21569376
  82. Cyclin B1 appeared to be involved in the genesis or progression of breast cancers. PMID: 21488187
  83. Cdc14B-dependent modulation of Cdc25 phosphatase and Cdk1/cyclin B activity is linked to correct chromosome segregation and bipolar spindle formation, processes that are required for proper progression through mitosis and maintenance of genomic stability. PMID: 21379580
  84. The activity of the Cdc2-cyclin B1 complex was significantly decreased in HHV-6A-infected HSB-2 cells leading to a cell cycle arrest in the G2/M phase in the cells. PMID: 21525341
  85. findings demonstrate that Cdc2/cyclin B1 is a key regulator in maintaining appropriate degradation and subcellular localization of Nlp, providing novel insights into understanding on the role of Cdc2/cyclin B1 in mitotic progression PMID: 20890132
  86. The optimal cyclin-binding sequence ((43)RRLL(46)) within this E4 motif is required for G2/M arrest of primary keratinocytes and correlates with cytoplasmic retention of cyclin B1, but not cyclin A. PMID: 21276999
  87. Cyclin B1, p34(cdc2) and p-survivin may play a key role during the mitosis and proliferation of oral submucosal fibrosis. PMID: 19134343
  88. Data show that FOXK2 is subject to control by cell cycle-regulated hyperphosphorylation occurring in CDK).cyclin-dependent manner with CDK1.cyclin B as the major kinase complex. PMID: 20810654
  89. Sustained spindle-assembly checkpoint response requires de novo transcription and translation of cyclin B1. PMID: 20927403
  90. Data suggest that targeting cyclin B1 might be an attractive strategy for preventing and treating papillomavirus-associated cancer by reactivating p53 and by reducing the Cdk1 activity. PMID: 20661218
  91. anti-apoptotic function of mitochondrial p53 regulated by cyclin B1/Cdk1-mediated Ser-315 phosphorylation PMID: 20808790
  92. Data report that endogenous cyclin B1-Cdk1 is recruited in a Cks-dependent manner to checkpoint-inhibited, phosphorylated APC/C in prometaphase independently of Cdc20 or the cyclin B1 D box. PMID: 20733055
  93. Data suggest that phosphorylation of Mcl-1 by CDK1-cyclin B1 and its APC/C(Cdc20)-mediated destruction initiates apoptosis if a cell fails to resolve mitosis. PMID: 20526282
  94. DH166 blocks cancer cell proliferation, causes a mitotic arrest, increases cyclin B1 accumulation, induces aberrant mitotic spindles and apoptosis, presumably due to the downregulation of PLK1 PMID: 19855194
  95. the expression of cyclin B1 was associated with regional lymph node metastasis and poor prognosis in gastric cancer. PMID: 20334896
  96. Cdc25A is a pro-apoptotic protein that amplifies staurosporine-induced apoptosis through the activation of cyclin B1/Cdc2 by its C-terminal domain PMID: 20368335
  97. Cdc25 phosphatases are required for timely assembly of CDK1-cyclin B at the G2/M transition PMID: 20360007
  98. CyclinB1, FHIT and Ki-67 may play significant roles in the occurrence and evolution of gastric carcinoma. PMID: 20095356
  99. Data show that the intrinsic link between cyclin B1-Cdk1 activation and its rapid nuclear import inherently coordinates the reorganization of the nucleus and the cytoplasm at mitotic entry. PMID: 20404109
  100. CKbeta8- and CKbeta8-1-induced activation of ERK1/2 is mediated by the G(i)/G(o) protein, PLC, and PKCdelta. PMID: 20097574

Show More

Hide All

Subcellular Location Cytoplasm, Nucleus, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome
Protein Families Cyclin family, Cyclin AB subfamily
Database Links

HGNC: 1579

OMIM: 123836

KEGG: hsa:891

STRING: 9606.ENSP00000256442

UniGene: Hs.23960

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1