Recombinant Human Interferon beta (IFNB1)

In Stock Promotion
Code CSB-EP011048HUe1
Abbreviation Recombinant Human IFNB1 protein
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
(IFN-beta)(Fibroblast interferon)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
22-187aa
Target Protein Sequence
MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has antiviral, antibacterial and anticancer activities.
Gene References into Functions
  1. Data indicate a mechanism used by monocyte chemotactic protein-inducing protein 1 (MCPIP1) to negatively regulated type I IFN interferon-beta antiviral defense. PMID: 29920243
  2. It has been shown that HCMV has evolved mutational robustness against IFN-beta by limiting the presence of APOBEC3G hot spots in essential open reading frames of its genome. PMID: 30045985
  3. RIG-I-like receptors have a role in induction of interferon-beta1 in antiviral gene expression PMID: 29098213
  4. Transcriptomic analysis of early untreated dermatomyositis muscles revealed that the main cluster of down-regulated genes was mitochondria-related. Histochemical, electron microscopy, and in situ oxygraphy analysis showed mitochondrial abnormalities, including increased reactive oxygen species (ROS) production and decreased respiration, which was correlated with low exercise capacities and a type I IFN signature. PMID: 28623559
  5. Gas6 bound to the fiber proteins of adenovirus and suppressed IFN beta production. PMID: 29288958
  6. The overexpression of NPIPB3 restored the interferon-beta responses in severe acute respiratory syndrome coronavirus open reading frame 6 (SARS-CoV ORF6) expressing cells, indicating that the interaction of SARS CoV ORF6 and NPIPB3 reduced Type I interferon antagonism by SARS-CoV ORF6. PMID: 26320399
  7. The results demonstrate that cystatin B interferes with the STAT-1 signaling and IFN-beta-antiviral responses perpetuating HIV in macrophage reservoirs. PMID: 27137788
  8. This review briefly discusses the dysregulation of main T cell subpopulations in CNS autoimmunity and summarized the T cell targeted effects of endogenous and exogenous IFN-beta in health and EAE/MS, with emphasis on the direct actions of IFN-beta on each T cell subset involved in the disease. PMID: 27033173
  9. c-Cbl negatively regulates IFN-beta signaling and cellular antiviral response by promoting IRF3 ubiquitination and degradation. PMID: 27503123
  10. YPEL5 silencing enhanced the induction of IFNB1 by pattern recognition receptors and phosphorylation of TBK1/IKBKE kinases, whereas co-immunoprecipitation experiments revealed that YPEL5 interacted physically with IKBKE. PMID: 27705791
  11. The effect of topical TREX1 knockdown and local interferon production on HIV transmission in human cervicovaginal explants and humanized mice, is reported. PMID: 27184854
  12. The current knowledge on IFNbeta from its structure, dynamic conformation, signaling pathway, and mechanism of action to its therapeutic effects is summarized. PMID: 27572132
  13. this study shows that the IFN-beta/STAT1 pathway is dysregulated in inflammatory bowel disease PMID: 27220814
  14. results suggest that, in addition to its well-known signaling activity, IFN-beta may be directly antimicrobial and be part of a growing family of cytokines and chemokines, called kinocidins, that also have antimicrobial properties. PMID: 28411186
  15. This study demonstrates a novel pathway for elevated IFNbeta signaling in SLE that is not dependent on stimulation by immune complexes but rather is cell intrinsic and critically mediated by IFNbeta and MAVS. PMID: 28471483
  16. G45R mutation of NS1 slightly decreased NS1 binding to dsRNA but did not interfere with its suppression of RIG-I-mediated type I IFN production. PMID: 27405392
  17. Upon influenza virus infection, DPF2 dysregulated IFN-beta induction and expression of cytokines/chemokines and antiviral proteins. This study provides evidence that influenza virus utilizes DPF2 to escape host innate immunity. PMID: 28404846
  18. Overexpression of PKV VP3 blocked IFN-beta-induced activation of the STAT1/STAT2/IRF9 promoter in a dose-dependent manner. PMID: 28441586
  19. Data suggest that EV71 infection in enterocytes does not inhibit phosphorylation of STAT1/2 induced by IFN-beta, but p-STAT1/2 transport into the nucleus is significantly blocked; EV71 infection in enterocytes down-regulates expression of KPNA1 and induces degradation of cellular KPNA1 via caspase-3. [EV17 = Enterovirus 71] PMID: 28455446
  20. This study reveals that decreased induction of both PKR and p300 proteins contribute to impaired induction of IFN-beta in Chronic obstructive pulmonary disease primary bronchial epithelial cells upon influenza infection. PMID: 26807508
  21. Together, these results suggest that RSV infection of MSCs alters their immune regulatory function by upregulating IFN-b and IDO, affecting immune cell proliferation, which may account for the lack of protective RSV immunity and for chronicity of RSV-associated lung diseases such as asthma and COPD. PMID: 27695127
  22. ArfGAP domain-containing protein 2 (ADAP2) is identified as a key novel scaffolding protein that integrates different modules of the RIG-I pathway, located at distinct subcellular locations, and mediates cellular antiviral type I interferon production. PMID: 27956705
  23. TBK1 complexes required for the phosphorylation of IRF3 and the production of interferon-beta have been identified. PMID: 28159912
  24. RNAs isolated from HCV-replicating cells triggered robust IFN-beta and IFN-lambda production through MDA5. PMID: 27655134
  25. These results suggest that inhibition of RIG-I-mediated type I interferon responses by Enterovirus 71 may contribute to the pathogenesis of viral infection. PMID: 27633794
  26. the interactions of IRF1, IFN-beta and IRF5 are involved in the M1 polarization of macrophages and have antitumor functions. PMID: 27176664
  27. The results demonstrate that PASylation has a positive impact on stability, solubility, and functional activity of IFN-beta1b and potentially might improve pharmacokinetic properties of the molecule as a therapeutic agent. PMID: 27833991
  28. Data suggest that interferon beta (IFN-beta) might be involved in modulating the expressions of interferon regulatory factor 1 (IRF1) and interferon regulatory factor-5 protein (IRF5) as well as maintaining the M1 polarization status and its function. PMID: 27363262
  29. Results suggest that serum levels of IFN-beta do not correlate well with the severity of dengue illness, but there is a clear association between changes in IFN-beta levels and the days of evolution during the acute phase of the disease. PMID: 26252251
  30. Overexpression of KLF4 inhibited virus-induced activation of ISRE and IFN-b promoter in cells, while knockdown of KLF4 potentiated viral infection-triggered induction of IFNB1 and downstream genes and attenuated viral replication. PMID: 25531393
  31. These findings suggest that RNF166 positively regulates RNA virus-triggered IFN-beta production by enhancing the ubiquitination of TRAF3 and TRAF6. PMID: 26456228
  32. the suppression of type I IFN production by HTLV-1 Tax through interaction with and inhibition of TBK1 kinase that phosphorylates IRF3 PMID: 26819312
  33. IFN-b could be an effective agent not only through its cell growth inhibitory effect on GSCs but also as a means of targeting the interconversion between GSCs and non-GSCs. PMID: 26397698
  34. These results demonstrate that poliovirus infection actively suppresses the host type I interferon response by blocking activation of IRF-3 and suggests that this is not mediated by cleavage of MDA-5 or IPS-1. PMID: 26437794
  35. The Hantaan virus A9 N protein can influence the host innate immune response by regulating the activation of IFNbeta. PMID: 26196448
  36. Together, the data demonstrate that interferon-beta inhibits foamy virus early in infection and that MxB is not a restriction factor of foamy virus. PMID: 26609934
  37. The C-terminal region of Toscana Virus NSs protein is critical for interferon-beta antagonism and protein stability. PMID: 26474372
  38. These findings support a model in which a measles virus defective interfering RNA is sensed by PACT and RIG-I to initiate an innate antiviral response via activation of interferon-beta production. PMID: 26608320
  39. Data suggest microRNA-302c regulates interferon-beta production in innate/mucosal immunity partly via down-regulation of interferon regulatory factors IRF3/7; studies were conducted in lung epithelial cells infected with influenza A virus H3N2. PMID: 26602079
  40. Data show that the MAPKKK6 ASK2, a modulator of MAPKKK5 ASK1 signaling, was essential for ASK1-dependent apoptosis, but not for inducing interferon-beta (IFNB) expression. PMID: 26243192
  41. Data suggest ADAP2 (an interferon-beta stimulated gene) disrupts pathogenic internalization of some RNA viruses/virions (dengue, vesicular stomatitis) by altering ADP ribosylation factor 6-mediated processes including up-regulation of pinocytosis. PMID: 26372645
  42. Data suggest that naturally occurring iDVGs (immunostimulatory defective viral genomes) trigger robust host antiviral/innate immunity responses including/requiring up-regulation of IFNB1 and IFNL1 (interferon lambda 1) in respiratory mucosa. PMID: 26336095
  43. Data identify an IFNbeta1-dependent, cell-autonomous mechanism that contributes to the therapeutic resistance of melanoma via the PKCepsilon-ATF2 regulatory axis. PMID: 25728676
  44. Early IFN-beta induction regulated virus replication in glioblastoma cells, whereas delayed IFN-beta induction resulted in efficient virus replication in neuroblastoma cells. PMID: 25920530
  45. Virion-associated R6 the type I IFN response by preventing efficient binding of IRF3/CBP complexes to the IFN-beta promoter in the context of infection. PMID: 25972548
  46. new IFN-beta response genes were identified in B cells, with possible implications to B cell-specific functions PMID: 25025430
  47. Reduced myelin basic protein-induced CD4+ T-cell autoreactivity in interferon-beta-treated multiple sclerosis patients may be mediated by monocyte-derived interleukin-10 PMID: 25738751
  48. Influenza virus-infected cells respond with increased induction of interferon beta upon Staphylococcus aureus super-infection, however, subsequent interferon-stimulated gene expression are rather impaired due to a block of STAT1-STAT2 dimerization. PMID: 25293394
  49. Paracrine signaling increases the number of cells that express Ifnb1 over time, calibrating the immune response to viral infection. PMID: 25670204
  50. Data suggest that BRD4 (bromodomain containing 4) is essential for Toll-like receptor-stimulated interferon-beta (IFNB) gene transcription by permitting transcription factors to interact with the IFNB promoter in plasmacytoid dendritic cells. PMID: 25891802

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Alpha/beta interferon family
Database Links

HGNC: 5434

OMIM: 147640

KEGG: hsa:3456

STRING: 9606.ENSP00000369581

UniGene: Hs.93177

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*