Recombinant Human Interferon beta protein(IFNB1)

Code CSB-EP011048HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P01574
Relevance Has antiviral, antibacterial and anticancer activities.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Fibroblast interferon
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Research Area Immunology
Source E.coli
Gene Names IFNB1
Expression Region 22-187aa
Tag Info N-terminal GST-tagged
Mol. Weight 47.0kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Has antiviral, antibacterial and anticancer activities.
Subcellular Location Secreted
Protein Families Alpha/beta interferon family
Database Links

HGNC: 5434

OMIM: 147640

KEGG: hsa:3456

STRING: 9606.ENSP00000369581

UniGene: Hs.93177

Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Necroptosis
Natural killer cell mediated cytotoxicity
NOD-like receptor signaling pathway
Osteoclast differentiation
Toll-like receptor signaling pathway

Related Products

IFNB1 Antibodies

IFNB1 Antibodies for Human

IFNB1 Antibodies for Homo sapiens (Human)

IFNB1 Proteins

IFNB1 Proteins for Homo sapiens (Human)

IFNB1 ELISA Kit

IFNB1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.