Recombinant Human Interferon gamma(IFNG)

Code CSB-YP011050HU
Product Type Recombinant Protein
Size Pls inquiry other sizes
Uniprot No. P01579
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Relevance Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Immune interferon
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
Research Area Stem Cells
Source Yeast
Gene Names IFNG
Protein Names Recommended name: Interferon gamma Short name= IFN-gamma Alternative name(s): Immune interferon
Expression Region 24-161aa
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Product Info N-terminal 6xHis-tagged
Mol. Weight 18.2kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
Involvement in disease Aplastic anemia (AA)
Subcellular location Secreted
Pathway HIF-1 signaling pathway
Jak-STAT signaling pathway
TGF-beta signaling pathway
Necroptosis
Antigen processing and presentation
IL-17 signaling pathway
Natural killer cell mediated cytotoxicity
Osteoclast differentiation
T cell receptor signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation

Related Products

IFNG Antibodies

IFNG Antibodies for Homo sapiens (Human)

IFNG Antibodies for Rattus norvegicus (Rat)

IFNG Antibodies for Mus musculus (Mouse)

IFNG Antibodies for Bos taurus (Bovine)

IFNG Antibodies for Sus scrofa (Pig)

IFNG Antibodies for Macaca thibetana (Pere David's macaque) (Tibetan macaque)

IFNG Proteins

IFNG Proteins for Capra hircus (Goat)

IFNG Proteins for Ovis aries (Sheep)

IFNG Proteins for Sus scrofa (Pig)

IFNG Proteins for Oryctolagus cuniculus (Rabbit)

IFNG Proteins for Canis lupus familiaris (Dog) (Canis familiaris)

IFNG Proteins for Equus caballus (Horse)

IFNG Proteins for Felis catus (Cat) (Felis silvestris catus)

IFNG Proteins for Gallus gallus (Chicken)

IFNG Proteins for Macaca mulatta (Rhesus macaque)

IFNG Proteins for Bos taurus (Bovine)

IFNG Proteins for Mus musculus (Mouse)

IFNG Proteins for Equus asinus (Donkey) (Equus africanus asinus)

IFNG Proteins for Homo sapiens (Human)

IFNG Proteins for Cervus elaphus (Red deer)

IFNG Proteins for Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)

IFNG Proteins for Callithrix jacchus (White-tufted-ear marmoset)

IFNG Proteins for Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

IFNG Proteins for Macaca nemestrina (Pig-tailed macaque)

IFNG Proteins for Rattus norvegicus (Rat)

IFNG Proteins for Mustela putorius furo (European domestic ferret) (Mustela furo)

IFNG Proteins for Mesocricetus auratus (Golden hamster)

IFNG Proteins for Marmota monax (Woodchuck)

IFNG Proteins for Phasianus colchicus colchicus (Black-necked pheasant)

IFNG Proteins for Numida meleagris (Helmeted guineafowl) (Phasianus meleagris)

IFNG Proteins for Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)

IFNG Proteins for Meleagris gallopavo (Wild turkey)

IFNG Proteins for Dasypus novemcinctus (Nine-banded armadillo)

IFNG Proteins for Vulpes vulpes (Red fox)

IFNG Proteins for Bubalus carabanensis (Swamp type water buffalo) (Bubalus bubalis carabanensis)

IFNG Proteins for Ailuropoda melanoleuca (Giant panda)

IFNG Proteins for Macaca thibetana (Pere David's macaque) (Tibetan macaque)

IFNG Proteins for Phodopus sungorus (Striped hairy-footed hamster) (Djungarian hamster)

IFNG Proteins for Meriones unguiculatus (Mongolian jird) (Mongolian gerbil)

IFNG Proteins for Moschus berezovskii (Chinese forest musk deer)

IFNG Proteins for Peromyscus maniculatus (North American deer mouse)

IFNG Proteins for Camelus bactrianus (Bactrian camel)

IFNG Proteins for Papio anubis (Olive baboon)

IFNG Proteins for Lama glama (Llama)

IFNG Proteins for Bos indicus (Zebu)

IFNG Proteins for Saimiri sciureus (Common squirrel monkey)

IFNG Proteins for Bubalus bubalis (Domestic water buffalo)

IFNG Proteins for Sigmodon hispidus (Hispid cotton rat)

IFNG Proteins for Tursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus)

IFNG Proteins for Pan troglodytes (Chimpanzee)

IFNG Proteins for Anas platyrhynchos (Mallard) (Anas boschas)

IFNG cDNA

IFNG cDNA for Oryctolagus cuniculus (Rabbit)

IFNG cDNA for Papio anubis (Olive baboon)

IFNG cDNA for Equus caballus (Horse)

IFNG cDNA for Canis lupus familiaris (Dog) (Canis familiaris)

IFNG cDNA for Felis catus (Cat) (Felis silvestris catus)

IFNG cDNA for Gallus gallus (Chicken)

IFNG cDNA for Macaca mulatta (Rhesus macaque)

IFNG cDNA for Rattus norvegicus (Rat)

IFNG cDNA for Bos taurus (Bovine)

IFNG cDNA for Sus scrofa (Pig)

IFNG cDNA for Ovis aries (Sheep)

IFNG ELISA Kit

IFNG ELISA Kit for Bos taurus (Bovine)

IFNG ELISA Kit for Gallus gallus (Chicken)

IFNG ELISA Kit for Canis lupus familiaris (Dog) (Canis familiaris)

IFNG ELISA Kit for Capra hircus (Goat)

IFNG ELISA Kit for Equus caballus (Horse)

IFNG ELISA Kit for Homo sapiens (Human)

IFNG ELISA Kit for Macaca mulatta (Rhesus macaque)

IFNG ELISA Kit for Mus musculus (Mouse)

IFNG ELISA Kit for Sus scrofa (Pig)

IFNG ELISA Kit for Oryctolagus cuniculus (Rabbit)

IFNG ELISA Kit for Rattus norvegicus (Rat)

IFNG ELISA Kit for Ovis aries (Sheep)

IFNG ELISA Kit for Mesocricetus auratus (Golden hamster)

Most popular with customers

+ Show More

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.