Recombinant Human Interferon gamma(IFNG)

Code CSB-YP011050HU
Product Type Recombinant Protein
Size US$283
Uniprot No. P01579
Relevance Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Immune interferon
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
Research Area Stem Cells
Source Yeast
Gene Names IFNG
Protein Names Recommended name: Interferon gamma Short name= IFN-gamma Alternative name(s): Immune interferon
Expression Region 24-161aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 18.2kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
Involvement in disease Aplastic anemia (AA)
Subcellular Location Secreted
Protein Families Type II (or gamma) interferon family
Tissue Specificity Released primarily from activated T lymphocytes.
Database Links

HGNC: 5438

OMIM: 147570

KEGG: hsa:3458

STRING: 9606.ENSP00000229135

UniGene: Hs.856

Pathway HIF-1 signaling pathway
Jak-STAT signaling pathway
TGF-beta signaling pathway
Necroptosis
Antigen processing and presentation
IL-17 signaling pathway
Natural killer cell mediated cytotoxicity
Osteoclast differentiation
T cell receptor signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation

Related Products

IFNG Antibodies

IFNG Antibodies for Homo sapiens (Human)

IFNG Antibodies for Rattus norvegicus (Rat)

IFNG Antibodies for Chicken

IFNG Antibodies for Guinea Pig

IFNG Antibodies for Mus musculus (Mouse)

IFNG Antibodies for Human

IFNG Antibodies for Bovine

IFNG Antibodies for Bos taurus (Bovine)

IFNG Antibodies for Sus scrofa (Pig)

IFNG Antibodies for Macaca thibetana (Pere David's macaque) (Tibetan macaque)

IFNG Proteins

IFNG Proteins for Capra hircus (Goat)

IFNG Proteins for Sus scrofa (Pig)

IFNG Proteins for Oryctolagus cuniculus (Rabbit)

IFNG Proteins for Canis lupus familiaris (Dog) (Canis familiaris)

IFNG Proteins for Equus caballus (Horse)

IFNG Proteins for Felis catus (Cat) (Felis silvestris catus)

IFNG Proteins for Macaca mulatta (Rhesus macaque)

IFNG Proteins for Bos taurus (Bovine)

IFNG Proteins for Equus asinus (Donkey) (Equus africanus asinus)

IFNG Proteins for Cervus elaphus (Red deer)

IFNG Proteins for Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)

IFNG cDNA

IFNG cDNA for Oryctolagus cuniculus (Rabbit)

IFNG cDNA for Papio anubis (Olive baboon)

IFNG ELISA Kit

IFNG ELISA Kit for Bos taurus (Bovine)

IFNG ELISA Kit for Gallus gallus (Chicken)

IFNG ELISA Kit for Canis lupus familiaris (Dog) (Canis familiaris)

IFNG ELISA Kit for Capra hircus (Goat)

IFNG ELISA Kit for Equus caballus (Horse)

IFNG ELISA Kit for Homo sapiens (Human)

IFNG ELISA Kit for Monkey

IFNG ELISA Kit for Mus musculus (Mouse)

IFNG ELISA Kit for Sus scrofa (Pig)

IFNG ELISA Kit for Oryctolagus cuniculus (Rabbit)

IFNG ELISA Kit for Rattus norvegicus (Rat)

IFNG ELISA Kit for Ovis aries (Sheep)

IFNG ELISA Kit for Duck

IFNG ELISA Kit for Mesocricetus auratus (Golden hamster)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.