Recombinant Human Interferon gamma (IFNG) (Active)

In Stock
Code CSB-MP011050HU1d7
Abbreviation Recombinant Human IFNG protein (Active)
MSDS
Size $98
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA.Immobilized Human IFNG at 2 μg/ml can bind anti-IFNG recombinant antibody (CSB-RA011050MA1HU).The EC50 is 74.23-96.56 ng/mL. Biological Activity Assay
  • Activity
    Measured by its ability to inhibit proliferation of HT-29 cells.The ED5050 for this effect is 0.2120-0.2940 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA.Immobilized Human IFNG at 2 μg/mL can bind anti-IFNG recombinant antibody (CSB-RA011050MA1HU).The EC50 is 74.23-96.56 ng/mL.
②Measured by its ability to inhibit proliferation of HT-29 cells.The ED50 for this effect is 0.2120-0.2940 ng/mL.
Target Names
Uniprot No.
Alternative Names
Interferon gamma; IFN-gamma; Immune interferon; IFNG
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
24-166aa
Target Protein Sequence
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Mol. Weight
18.2 kDa
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Interferon gamma orchestrates adaptive immunity by activating macrophages, upregulating MHC expression, and polarizing T helper cell differentiation, making precise control of its signaling dose essential in mechanistic studies. This recombinant human IFNG demonstrates potent antiproliferative activity with an ED50 of 0.21–0.29 ng/mL in HT-29 cell assays, providing a quantitative benchmark for dose-response experiments in cell-based functional assays including primary T cell activation, macrophage polarization, and tumor cell growth inhibition studies. The protein binds its cognate antibody with an EC50 of 74–97 ng/mL in functional ELISA, supporting its use as a coating antigen in antibody development workflows and as a positive control in cytokine detection platforms. With endotoxin levels below 1.0 EU/μg and purity exceeding 90%, this preparation meets the quality thresholds commonly required for JAK/STAT signaling pathway analysis and in vivo inflammation models where LPS contamination would confound immune cell responses.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Primarily signals through the JAK-STAT pathway after interaction with its receptor IFNGR1 to affect gene regulation. Upon IFNG binding, IFNGR1 intracellular domain opens out to allow association of downstream signaling components JAK2, JAK1 and STAT1, leading to STAT1 activation, nuclear translocation and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors such as IRF1 that are able to further drive regulation of a next wave of transcription. Plays a role in class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits. In turn, increases the quantity, quality, and repertoire of peptides for class I MHC loading. Increases the efficiency of peptide generation also by inducing the expression of activator PA28 that associates with the proteasome and alters its proteolytic cleavage preference. Up-regulates as well MHC II complexes on the cell surface by promoting expression of several key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL. Participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions by affecting their development, quiescence, and differentiation.
Gene References into Functions
  1. Impaired IFNgamma-Signaling and Mycobacterial Clearance in IFNgammaR1-Deficient Human iPSC-Derived Macrophages. PMID: 29249666
  2. High expression of IFNG is associated with breast cancer. PMID: 30336781
  3. results suggest, the interplay of pro-inflammatory cytokines IFN-gamma derived from CD4+T lymphocytes and TNF-alpha from CD14+ cells has no direct additive impact on parasite replication but induces IL-4 production. PMID: 29953494
  4. IFN-lambda may participate in local inflammation in the salivary glands of primary Sjogren's syndrome patients through direct and indirect regulations of the expressions of BAFF and CXCL10 in salivary gland epithelium. PMID: 28421993
  5. The expression of CXCL10 mRNA and IFN-gamma mRNA was significantly higher in non-lesional and perilesional skin of vitiligo and alopecia areata patients compared with the skin of healthy controls; however, the level of expression of CXCL10 and IFN-gamma in lesional skin was not different than that in healthy skin PMID: 27863059
  6. High IFNG expression is associated with Chronic Periodontitis. PMID: 30051674
  7. hypomethylation of the IFNG promoter is significantly related to the risk of essential hypertension PMID: 29643275
  8. These results demonstrated that the IFNGinduced immunosuppressive properties of B7H1 in human BM and WJMSCs were mediated by STAT1 signaling, and not by PI3K/RACalpha serine/threonineprotein kinase signaling PMID: 29901104
  9. serum IP-10 level and the IFN-gamma/IL-4 ratio have great potential to predict significant fibrosis among chronic hepatitis B patients. PMID: 28067328
  10. IFN-gamma increases free ISG15 levels in the cytoplasm and ISGylation in the nucleus and cytoplasm, but in a manner distinct between MCF-7 and MDA-MB-231cells. PMID: 29626479
  11. the expression of IFN-gamma and IL-17 was also suppressed by IRAK1/4 inhibitor both in active Behcet's patients and in normal subjects. PMID: 28780618
  12. IFNgamma induces a rapid activation of aerobic glycolysis followed by a reduction in oxidative phosphorylation in M1 macrophages. PMID: 29463472
  13. Results provide evidence that rs2069707 locus SNPs of IFN-gamma is a risk factor for contracting tuberculous pericarditis. PMID: 30017738
  14. No correlation was observed between interferon gamma mRNA/protein levels and recurrent depressive disorders. PMID: 29367100
  15. Aberrant IFN-gamma promoter methylation may be involved in the process of tumorigenesis of oral cancer. PMID: 28091876
  16. this study shows that elevated levels of interferon-gamma are associated with high levels of Epstein-Barr virus reactivation in patients with the intestinal type of gastric cancer PMID: 29349089
  17. This study contributes to clarification of the previously inconsistent prognostic performance of IFNgamma by providing the first prognostic evaluation with long follow-up, time-dependence assessment and absence of any chemotherapy influence. PMID: 29478965
  18. Association Between the Interferon Gamma 874 T/A Polymorphism and the Severity of Valvular Damage in Patients with Rheumatic Heart Disease. PMID: 29332266
  19. IFN-gamma can promote cancer immunoevasion. (Review) PMID: 29283429
  20. an electrophoretic mobility shift assay showed that signal transducers and activators of transcription 1 (STAT1) attach to the GAS motif on the human STING promoter region. This indicates that IFN-gamma/Janus kinases/STAT1 signaling is essential for the STING upregulation in human keratinocytes. PMID: 29143896
  21. we review the direct and indirect effects of IFN-gamma on hematopoiesis, as well as the underlying signaling mechanisms of how IFN-gamma modulates the self-renewal, cell cycle entry, and proliferation of hematopoietic stem cells PMID: 28852997
  22. IFN-gamma +874T allele may increase the risk of ocular lesions in Toxoplasma infection. The principle of natural selection seems to also play a role. The less common TNF-308A allelic form could be protective against the development of Toxoplasma ocular infection. PMID: 27081842
  23. this study shows the age-related reductions in serum and PBMC IFN-gamma in healthy nonobese subjects PMID: 28762199
  24. Phosphorylation of T-bet by RSK2 is required for IFNgamma expression for attenuation of colon cancer metastasis and growth. PMID: 29133416
  25. SNX8 mediates IFNG-triggered non-canonical signaling pathway and host defense against Listeria monocytogenes. PMID: 29180417
  26. the frequencies of IFNgamma and IL-17A(+) cells were increased in the antrum, particularly in patients with H. pylori induced gastric ulcers. PMID: 28683359
  27. rs2069718 in the IFNG gene was significantly associated with pulmonary tuberculosis but not spinal tuberculosis. PMID: 28867622
  28. IFN-gamma was associated with a cerebral volume reduction in systemic lupus erythematosus with central nervous system involvement PMID: 28848179
  29. Data suggest that semen exhibits substantial individual variation over time in pro-inflammatory seminal fluid cytokines IFNG and CXCL8. (IFNG = interferon gamma; CXCL8 = C-X-C motif chemokine ligand 8) PMID: 28541460
  30. Dysregulation of the IFN-gamma-STAT1 signaling pathway in a cell line model of large granular lymphocyte leukemia PMID: 29474442
  31. STAT1b plays a key role in enhancing the tumor suppressor function of STAT1a, in ESCC, in a manner that can be amplified by IFN-gamma PMID: 28981100
  32. epigenetic silencing by single CpG methylation determines differential IL18BP inducibility in monocytic versus epithelial cells. T PMID: 29409936
  33. Systemic IFN activation is associated with higher activity only in the ESSDAI biological domain but not in other domains or the total score. Our data raise the possibility that the ESSDAI biological domain score may be a more sensitive endpoint for trials targeting either IFN pathway. PMID: 29474655
  34. These findings suggest that IFN-a can inhibit HCV replication through a STAT2-dependent but STAT1-independent pathway, whereas IFN-g induces ISG expression and inhibits HCV replication exclusively through a STAT1- and STAT2-dependent pathway. PMID: 27929099
  35. rs1861493 and rs2430561 polymorphisms were conformed to be in HWE in genotypes distribution of the control group (P>0.05 for both). However, only TT genotype and T allele of rs2430561 presented significantly higher frequencies in Ankylosing Spondylitis patients than in healthy controls. IFN-g rs2430561 polymorphism may contribute to the risk of IFN-g rs2430561 polymorphism may contributhrough influencing IFN-g expression. PMID: 28843049
  36. Interactions among polymorphisms of IFN-gamma+874 AA, IL-2-330 TT, IL-10-1082 AA, IL10--592 AC and IL-4-589 CC/CT significantly influenced the clinical progression of the subjects with hepatitis B virus and/or hepatitis C virus infection. PMID: 28838891
  37. Ex vivo interferon-gamma production is a useful biomarker for assessing disease activity and predicting poor clinical outcomes of systemic lupus erythematosus patients. PMID: 28841837
  38. this study demonstrates reduced IFN-gamma production in chronic brucellosis patients PMID: 28919584
  39. These data suggest that the de novo expression of PDL1 on tumor cells is upregulated by IFN-g secreted from CD8+ TILs upon recognition of the tumor cells with an MHC class I molecule. PMID: 28791392
  40. H pylori expression of cgt reduces cholesterol levels in infected gastric epithelial cells and thereby blocks IFNG signaling, allowing the bacteria to escape the host inflammatory response. PMID: 29273450
  41. Strategies to block MICA-NKG2D interactions resulted in reductions in IFNgamma production. Depletion of monocytes in vivo resulted in decreased IFNgamma production by murine NK cells upon exposure to Ab-coated tumor cells PMID: 28724544
  42. study concluded that the IFN-gamma (874A/T) polymorphism is associated with the susceptibility to oral lichen planus PMID: 27544215
  43. IFN gamma induced upregulation of BCL6 was dependent on the classical STAT1 signaling pathway, and affected both major BCL6 variants. Interestingly, although IFN alpha induced stronger STAT1 phosphorylation than IFN gamma, it only slightly upregulated BCL6 in multiple myeloma lines. PMID: 29510136
  44. IFN-gamma, CXCL16 and uPAR are promising as effective biomarkers of disease activity, renal damage, and the activity of pathological lesions in systemic lupus erythematosus. PMID: 28628472
  45. serum levels of soluble FAS ligand (sFASL) and interferon gamma (IFN-gamma) were analyzed and correlated with sFGL2 levels in Hepatitis C Virus-Infected Patients and Hepatocellular Carcinoma Patients. PMID: 28609212
  46. IFN-gamma induces activated but insufficient autophagy and thus contributes to a degree to p62-dependent apoptosis of nasal epithelial cells in chronic rhinosinusitis with nasal polyps. PMID: 28258963
  47. results suggested that IFN-gamma induces autophagy-associated apoptosis in CRC cells via inducing cPLA2-dependent mitochondrial ROS production. PMID: 29551681
  48. Activated interferon-gamma-producing CD56(bright) NK cells are positioned to play a key role in the fibrotic process and progression to chronic kidney disease. PMID: 28396119
  49. Posttransplant immune monitoring by donor-specific IFN-gamma ELISPOT can assess risk for developing subclinical T-cell mediated rejection and anti-donor HLA antibodies. PMID: 28274484
  50. genetic polymorphism is not associated with increased susceptibility to chronic spontaneous urticaria in Iran PMID: 28159384

Show More

Hide All

Involvement in disease
Aplastic anemia (AA)
Subcellular Location
Secreted.
Protein Families
Type II (or gamma) interferon family
Tissue Specificity
Released primarily from activated T lymphocytes.
Database Links

HGNC: 5438

OMIM: 147570

KEGG: hsa:3458

STRING: 9606.ENSP00000229135

UniGene: Hs.856

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*