Recombinant Human Macrophage colony-stimulating factor 1 (CSF1), partial (Active)

In Stock
Code CSB-YP006043HU1
Abbreviation Recombinant Human CSF1 protein, partial (Active)
MSDS
Size $368
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156 Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of THP-1 cells is 0.5913-1.205 ng/mL.
Target Names
Uniprot No.
Alternative Names
Macrophage colony-stimulating factor 1; CSF-1; M-CSF; MCSF; Lanimostim; Proteoglycan macrophage colony-stimulating factor; Processed macrophage colony-stimulating factor 1; Macrophage colony-stimulating factor 1 43 kDa subunit; CSF1
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
33-190aa
Target Protein Sequence
EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN
Mol. Weight
19.9 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance.
Gene References into Functions
  1. In glioblastoma, colony-stimulating factor-1 and angiocrine IL-6 induce robust arginase-1 expression and macrophage alternative activation, mediated through peroxisome proliferator-activated receptor-gamma-dependent transcriptional activation of hypoxia-inducible factor-2alpha. PMID: 29422647
  2. Data showed that single expression of M-CSF or IL-34 can be observed in lung cancer tissues and correlated with poor survival. Additionally, their high co-expression correlates with disease stages and poor survival. Thus, evaluating the expression of both M-CSF and IL-34 may help to estimate disease progression and malignant degree in lung cancer patients. PMID: 29323162
  3. The functional rs2050462 in CSF-1 might have a substantial influence on the renal cell carcinoma susceptibility and evolution in the Chinese population. PMID: 29734839
  4. Study find elevated expression of CSF1 in primary gastric cancer tissue (GC) to be significantly associated with the presence of lymph node and peritoneal metastasis, advanced TNM stage, and poor survival. In vitro analysis also revealed a functional role for the CSF1 in GC development, and a prognostic and predictive biomarker for GC. PMID: 29767252
  5. Results suggest that monocytes from Crohn's disease patients in remission produced high levels of CSF-1 that upregulate CCR5 expression. Consequently, monocytes differentiated in these conditions had a characteristic phenotype and lower production of inflammatory cytokines. PMID: 28273887
  6. High M-CSF expression is associated with cervical cancer. PMID: 30052166
  7. Concerning pigmented villonodular synovitis , clinical trials assessing CSF-1R inhibitors have revealed promising initial outcomes. Blocking CSF-1/CSF-1R signaling represents a promising immunotherapy approach and several new potential combination therapies for future clinical testing. PMID: 28875266
  8. It was demonstrated that MCSF and folliclestimulating hormone stimulated the production of estradiol (E2) in luteinized granulosa cells. MCSF may be important in regulating the response of luteinized granulosa cells to gonadotropin and may have a promotive effect in the early phase of follicular development. PMID: 28656272
  9. miR-1207-5p and CSF1 expression levels and their relationship with lung cancer survival and metastasis status were assayed by means of a lung cancer tissue microarray. PMID: 27107415
  10. Upregulation of GM-CSF and M-CSF production by endothelial cells, an effect that appears to be mediated by NF-kappaB and to be independent of IL-1, may be an additional mechanism through which IL-33 contributes to inflammatory activation of the vessel wall. PMID: 27173404
  11. High CSF-1 expression is associated with Breast Cancer. PMID: 28687620
  12. Nucleolin both forms an mRNP complex with the eIF4G and CSF-1 mRNA, and is co-localized with the eIF4G in the cytoplasm further supporting nucleolin's role in translational regulation. PMID: 28131007
  13. study, therefore, provided insights into the sequence-structure-function relationships of the M-CSF/c-FMS interaction and of ligand/receptor tyrosine kinase interactions in general. PMID: 28655719
  14. Therefore, our findings indicate that CSF1 signaling is oncogenic during gliomagenesis through a mechanism distinct from modulating glioma-associated microglia/macrophage polarization status PMID: 27013192
  15. High CSF1 expression is associated with breast cancer. PMID: 27599777
  16. M-CSF has been shown to be comparable to CA15-3 and VEGF, specificity, and AUC values only in stages III and IV of BC. PMID: 27445439
  17. M-CSF macrophage conversion into foam cells reduces their proinflammatory responses to classical M1-polarizing activation PMID: 27038418
  18. This can be achieved by either blocking the EGF or CSF-1 receptors or supressing the EGF or CSF-1 signal. PMID: 26686751
  19. findings demonstrated that M-CSF binds to IL-34; molecular docking studies predicted the formation of a heteromeric M-CSF/IL-34 cytokine PMID: 26095744
  20. RGC-32 expression on M2-polarized and tumor-associated macrophages is M-CSF-dependent and enhanced by tumor-derived IL-4. PMID: 25418473
  21. Data show crystal structures of CSF1-CSF1R ternary complexes, and propose a mechanism for their cooperative action that relies on the adoption by dimeric CSF-1 of an active conformational state and homotypic receptor interactions. PMID: 26235028
  22. In patients with CLE, 100 and 150 mg PD-0360324 (monoclonal antibody against MCSF) every 2 weeks for 3 months suppressed a subset of circulating monocytes. PMID: 26376111
  23. peripheral nerve injury induced de novo expression of colony-stimulating factor 1 (CSF1) in injured sensory neurons. CSF1 was transported to the spinal cord, where it targeted the microglial CSF1 receptor (CSF1R). PMID: 26642091
  24. These findings highlight an essential role for PRKAA1-mediated autophagy during differentiation of human monocytes. PMID: 26029847
  25. These findings suggest a high usefulness of M-CSF in diagnosing the serous sub-type of epithelial ovarian cancer and in discriminating between cancer and non-carcinoma lesions PMID: 25935153
  26. expression and release, from osteoblasts of macrophage colony-stimulating factor (M-CSF), which is indispensable for osteoclast differentiation, was inhibited by uPAR loss. PMID: 25196912
  27. By identifying the M-CSFM residues critical for M-CSF-c-FMS interactions, we have laid down the basis for a deeper understanding of the M-CSF . c-FMS signaling mechanism PMID: 26359491
  28. Colony Stimulating Factors 1, 2, 3 and early pregnancy PMID: 25721620
  29. study shows up-regulation of MCSF in GBM via a SYK-PI3K-NFkappaB-dependent mechanism and identifies IGFBP1 released by microglial cells as a novel mediator of MCSF-induced angiogenesis PMID: 26245897
  30. macrophage colony-stimulating factor (M-CSF) may be involved in the regulation of epiphyseal plate injury and repair in Kashin-Beck disease. PMID: 25138985
  31. Determination of CSF1 and CSF1R expression may be useful as a prognosticator of the clinical course and/or outcomes of Pigmented villonodular synovitis . PMID: 25854167
  32. Our findings also suggest that next generation sequencing may help explore the pathogenesis and aid the diagnosis of Juvenile Paget's disease. PMID: 25891874
  33. results presented herein suggest a potential cross-talk between cancer cells and the microenvironment controlled by CSF1/Vav1 signaling pathways. PMID: 25313137
  34. None of SNPs among rs333967, rs2297706 and rs1058885 in CSF-1 was found statistically significantly associated with CP in Han Chinese with Shanghai origin. haplotype T-C-G showed statistically significant association with decreased risk in males. PMID: 24592910
  35. The aim of the present study was to assess the effect of soluble mediators produced by breast cancer cells on human osteoclast maturation in a co-culture model. PMID: 24956020
  36. FoxO1 is highly expressed in M-CSF-derived (M2-like) macrophage subsets, and this M2-like macrophages showed a preferential FoxO1 enrichment on the IL-10 promoter but not in GM-CSF-derived (M1-like) macrophages PMID: 25420919
  37. potent profibrotic factor in hepatitis C virus liver fibrosis PMID: 25066464
  38. Findings suggest the replacement of the 3'-UTR of CSF1 with other sequences in tenosynovial giant cell tumors. PMID: 24604026
  39. In a cohort of 453 human breast tumors, NCOA1 and CSF1 levels correlated positively with disease recurrence, higher tumor grade, and poor prognosis. PMID: 24769444
  40. high expression correlates with shorter metastasis-free survival in non-small-cell lung cancer patients PMID: 23870818
  41. genetic polymorphism is associated with platelet counts PMID: 24178511
  42. The findings of this study regarding the unique functional interplay between M-CSF and IL-32 increase our understanding of the mechanisms that regulate the survival and M1/M2 ratio of macrophages, as well as HIV-1 replication in macrophages. PMID: 24748497
  43. Elevated CSF1 serum level is associated with early breast cancer. PMID: 24016870
  44. This study is the first to illustrate downstream transcriptional profiles and pathways of IL-34 in comparison with CSF-1 and identify notable differences in CCR2 expression. PMID: 23684409
  45. Regulation of immediate-early gene response by THOC5, a member of mRNA export complex contributes to the M-CSF-induced macrophage differentiation. PMID: 24157873
  46. Nucleolin mediates microRNA-directed CSF-1 mRNA deadenylation but increases translation of CSF-1 mRNA. PMID: 23471483
  47. The results indicate usefulness of VEGF and M-CSF in diagnostics of breast cancer patients, especially in combination with CA 15-3. PMID: 23688065
  48. GPNMB expression was regulated by EpCAM and CSF-1 partly through their common downstream product c-myc PMID: 23924854
  49. The expression of CSF2 (but not CSF1) was highly up-regulated in glioblastoma patients and we found an inverse correlation between CSF2 expression and patient survival. PMID: 23520016
  50. the feline CSF-1R was cloned and the responsiveness to CSF-1 and IL-34 from a range of species, was examined. PMID: 23260168

Show More

Hide All

Involvement in disease
Aberrant expression of CSF1 or CSF1R can promote cancer cell proliferation, invasion and formation of metastases. Overexpression of CSF1 or CSF1R is observed in a significant percentage of breast, ovarian, prostate, and endometrial cancers.; DISEASE: Note=Aberrant expression of CSF1 or CSF1R may play a role in inflammatory diseases, such as rheumatoid arthritis, glomerulonephritis, atherosclerosis, and allograft rejection.
Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Processed macrophage colony-stimulating factor 1]: Secreted, extracellular space.
Database Links

HGNC: 2432

OMIM: 120420

KEGG: hsa:1435

STRING: 9606.ENSP00000327513

UniGene: Hs.173894

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*