Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①The ED50 as determined by the dose-dependent stimulation of the proliferation of THP-1 cells is 2.880-4.115 ng/mL.
②Measured by its binding ability in a functional ELISA. Immobilized Human CSF1 protein at 2 μg/mL can bind Anti-CSF1 recombinant antibody (CSB-RA006043MA1HU). The EC50 is 4.291-4.988 ng/mL.
③Measured by its binding ability in a functional ELISA. Immobilized Human CSF1 protein at 2 μg/mL can bind Human CSF1R protein (CSB-MP006044HU). The EC50 is 37.37-43.34 ng/mL.
Alternative Names
Macrophage colony-stimulating factor 1; CSF-1; M-CSF; MCSF; Lanimostim; Proteoglycan macrophage colony-stimulating factor; Processed macrophage colony-stimulating factor 1; Macrophage colony-stimulating factor 1 43 kDa subunit; CSF1
Species
Homo sapiens (Human)
Expression Region
33-190aa
Target Protein
Sequence
EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN
Tag Info
N-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid
repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage
temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.