Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①The ED50 as determined by the dose-dependent stimulation of the proliferation of THP-1 cells is 2.880-4.115 ng/mL.
②Measured by its binding ability in a functional ELISA. Immobilized Human CSF1 protein at 2 μg/mL can bind Anti-CSF1 recombinant antibody (CSB-RA006043MA1HU). The EC50 is 4.291-4.988 ng/mL.
③Measured by its binding ability in a functional ELISA. Immobilized Human CSF1 protein at 2 μg/mL can bind Human CSF1R protein (CSB-MP006044HU). The EC50 is 37.37-43.34 ng/mL.

Target Names

CSF1

Uniprot No.

P09603

Alternative Names

Macrophage colony-stimulating factor 1; CSF-1; M-CSF; MCSF; Lanimostim; Proteoglycan macrophage colony-stimulating factor; Processed macrophage colony-stimulating factor 1; Macrophage colony-stimulating factor 1 43 kDa subunit; CSF1

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

33-190aa

Target Protein Sequence

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN

Mol. Weight

21.2 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Macrophage colony-stimulating factor 1 governs the survival, proliferation, and differentiation of mononuclear phagocytes, making it a central regulator in both homeostatic tissue macrophage maintenance and pathological inflammation. This recombinant human CSF1, spanning residues 33–190 and expressed in mammalian cells to preserve native glycosylation, demonstrates potent bioactivity with an ED50 of 2.880–4.115 ng/mL in THP-1 cell proliferation assays, directly supporting dose-response studies of monocyte expansion, macrophage polarization experiments, and JAK/STAT or PI3K/AKT signaling pathway investigations. The endotoxin level below 1.0 EU/μg meets the stringent thresholds required for primary human monocyte cultures and bone marrow-derived macrophage differentiation protocols, where LPS contamination would confound cytokine-specific responses. Purity exceeding 95% by SDS-PAGE, combined with the validated proliferative activity, provides a reliable basis for use as a positive control in CSF1R binding assays, as an immunogen for antibody generation, and as a reference standard in cytokine quantification platforms.

Target Background

Function

Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance.

Gene References into Functions

In glioblastoma, colony-stimulating factor-1 and angiocrine IL-6 induce robust arginase-1 expression and macrophage alternative activation, mediated through peroxisome proliferator-activated receptor-gamma-dependent transcriptional activation of hypoxia-inducible factor-2alpha. PMID: 29422647
Data showed that single expression of M-CSF or IL-34 can be observed in lung cancer tissues and correlated with poor survival. Additionally, their high co-expression correlates with disease stages and poor survival. Thus, evaluating the expression of both M-CSF and IL-34 may help to estimate disease progression and malignant degree in lung cancer patients. PMID: 29323162
The functional rs2050462 in CSF-1 might have a substantial influence on the renal cell carcinoma susceptibility and evolution in the Chinese population. PMID: 29734839
Study find elevated expression of CSF1 in primary gastric cancer tissue (GC) to be significantly associated with the presence of lymph node and peritoneal metastasis, advanced TNM stage, and poor survival. In vitro analysis also revealed a functional role for the CSF1 in GC development, and a prognostic and predictive biomarker for GC. PMID: 29767252
Results suggest that monocytes from Crohn's disease patients in remission produced high levels of CSF-1 that upregulate CCR5 expression. Consequently, monocytes differentiated in these conditions had a characteristic phenotype and lower production of inflammatory cytokines. PMID: 28273887
High M-CSF expression is associated with cervical cancer. PMID: 30052166
Concerning pigmented villonodular synovitis , clinical trials assessing CSF-1R inhibitors have revealed promising initial outcomes. Blocking CSF-1/CSF-1R signaling represents a promising immunotherapy approach and several new potential combination therapies for future clinical testing. PMID: 28875266
It was demonstrated that MCSF and folliclestimulating hormone stimulated the production of estradiol (E2) in luteinized granulosa cells. MCSF may be important in regulating the response of luteinized granulosa cells to gonadotropin and may have a promotive effect in the early phase of follicular development. PMID: 28656272
miR-1207-5p and CSF1 expression levels and their relationship with lung cancer survival and metastasis status were assayed by means of a lung cancer tissue microarray. PMID: 27107415
Upregulation of GM-CSF and M-CSF production by endothelial cells, an effect that appears to be mediated by NF-kappaB and to be independent of IL-1, may be an additional mechanism through which IL-33 contributes to inflammatory activation of the vessel wall. PMID: 27173404
High CSF-1 expression is associated with Breast Cancer. PMID: 28687620
Nucleolin both forms an mRNP complex with the eIF4G and CSF-1 mRNA, and is co-localized with the eIF4G in the cytoplasm further supporting nucleolin's role in translational regulation. PMID: 28131007
study, therefore, provided insights into the sequence-structure-function relationships of the M-CSF/c-FMS interaction and of ligand/receptor tyrosine kinase interactions in general. PMID: 28655719
Therefore, our findings indicate that CSF1 signaling is oncogenic during gliomagenesis through a mechanism distinct from modulating glioma-associated microglia/macrophage polarization status PMID: 27013192
High CSF1 expression is associated with breast cancer. PMID: 27599777
M-CSF has been shown to be comparable to CA15-3 and VEGF, specificity, and AUC values only in stages III and IV of BC. PMID: 27445439
M-CSF macrophage conversion into foam cells reduces their proinflammatory responses to classical M1-polarizing activation PMID: 27038418
This can be achieved by either blocking the EGF or CSF-1 receptors or supressing the EGF or CSF-1 signal. PMID: 26686751
findings demonstrated that M-CSF binds to IL-34; molecular docking studies predicted the formation of a heteromeric M-CSF/IL-34 cytokine PMID: 26095744
RGC-32 expression on M2-polarized and tumor-associated macrophages is M-CSF-dependent and enhanced by tumor-derived IL-4. PMID: 25418473
Data show crystal structures of CSF1-CSF1R ternary complexes, and propose a mechanism for their cooperative action that relies on the adoption by dimeric CSF-1 of an active conformational state and homotypic receptor interactions. PMID: 26235028
In patients with CLE, 100 and 150 mg PD-0360324 (monoclonal antibody against MCSF) every 2 weeks for 3 months suppressed a subset of circulating monocytes. PMID: 26376111
peripheral nerve injury induced de novo expression of colony-stimulating factor 1 (CSF1) in injured sensory neurons. CSF1 was transported to the spinal cord, where it targeted the microglial CSF1 receptor (CSF1R). PMID: 26642091
These findings highlight an essential role for PRKAA1-mediated autophagy during differentiation of human monocytes. PMID: 26029847
These findings suggest a high usefulness of M-CSF in diagnosing the serous sub-type of epithelial ovarian cancer and in discriminating between cancer and non-carcinoma lesions PMID: 25935153
expression and release, from osteoblasts of macrophage colony-stimulating factor (M-CSF), which is indispensable for osteoclast differentiation, was inhibited by uPAR loss. PMID: 25196912
By identifying the M-CSFM residues critical for M-CSF-c-FMS interactions, we have laid down the basis for a deeper understanding of the M-CSF . c-FMS signaling mechanism PMID: 26359491
Colony Stimulating Factors 1, 2, 3 and early pregnancy PMID: 25721620
study shows up-regulation of MCSF in GBM via a SYK-PI3K-NFkappaB-dependent mechanism and identifies IGFBP1 released by microglial cells as a novel mediator of MCSF-induced angiogenesis PMID: 26245897
macrophage colony-stimulating factor (M-CSF) may be involved in the regulation of epiphyseal plate injury and repair in Kashin-Beck disease. PMID: 25138985
Determination of CSF1 and CSF1R expression may be useful as a prognosticator of the clinical course and/or outcomes of Pigmented villonodular synovitis . PMID: 25854167
Our findings also suggest that next generation sequencing may help explore the pathogenesis and aid the diagnosis of Juvenile Paget's disease. PMID: 25891874
results presented herein suggest a potential cross-talk between cancer cells and the microenvironment controlled by CSF1/Vav1 signaling pathways. PMID: 25313137
None of SNPs among rs333967, rs2297706 and rs1058885 in CSF-1 was found statistically significantly associated with CP in Han Chinese with Shanghai origin. haplotype T-C-G showed statistically significant association with decreased risk in males. PMID: 24592910
The aim of the present study was to assess the effect of soluble mediators produced by breast cancer cells on human osteoclast maturation in a co-culture model. PMID: 24956020
FoxO1 is highly expressed in M-CSF-derived (M2-like) macrophage subsets, and this M2-like macrophages showed a preferential FoxO1 enrichment on the IL-10 promoter but not in GM-CSF-derived (M1-like) macrophages PMID: 25420919
potent profibrotic factor in hepatitis C virus liver fibrosis PMID: 25066464
Findings suggest the replacement of the 3'-UTR of CSF1 with other sequences in tenosynovial giant cell tumors. PMID: 24604026
In a cohort of 453 human breast tumors, NCOA1 and CSF1 levels correlated positively with disease recurrence, higher tumor grade, and poor prognosis. PMID: 24769444
high expression correlates with shorter metastasis-free survival in non-small-cell lung cancer patients PMID: 23870818
genetic polymorphism is associated with platelet counts PMID: 24178511
The findings of this study regarding the unique functional interplay between M-CSF and IL-32 increase our understanding of the mechanisms that regulate the survival and M1/M2 ratio of macrophages, as well as HIV-1 replication in macrophages. PMID: 24748497
Elevated CSF1 serum level is associated with early breast cancer. PMID: 24016870
This study is the first to illustrate downstream transcriptional profiles and pathways of IL-34 in comparison with CSF-1 and identify notable differences in CCR2 expression. PMID: 23684409
Regulation of immediate-early gene response by THOC5, a member of mRNA export complex contributes to the M-CSF-induced macrophage differentiation. PMID: 24157873
Nucleolin mediates microRNA-directed CSF-1 mRNA deadenylation but increases translation of CSF-1 mRNA. PMID: 23471483
The results indicate usefulness of VEGF and M-CSF in diagnostics of breast cancer patients, especially in combination with CA 15-3. PMID: 23688065
GPNMB expression was regulated by EpCAM and CSF-1 partly through their common downstream product c-myc PMID: 23924854
The expression of CSF2 (but not CSF1) was highly up-regulated in glioblastoma patients and we found an inverse correlation between CSF2 expression and patient survival. PMID: 23520016
the feline CSF-1R was cloned and the responsiveness to CSF-1 and IL-34 from a range of species, was examined. PMID: 23260168

Hide All

Involvement in disease

Aberrant expression of CSF1 or CSF1R can promote cancer cell proliferation, invasion and formation of metastases. Overexpression of CSF1 or CSF1R is observed in a significant percentage of breast, ovarian, prostate, and endometrial cancers.; DISEASE: Note=Aberrant expression of CSF1 or CSF1R may play a role in inflammatory diseases, such as rheumatoid arthritis, glomerulonephritis, atherosclerosis, and allograft rejection.

Subcellular Location

Cell membrane; Single-pass type I membrane protein.; [Processed macrophage colony-stimulating factor 1]: Secreted, extracellular space.

Database Links

HGNC: 2432

OMIM: 120420

KEGG: hsa:1435

STRING: 9606.ENSP00000327513

UniGene: Hs.173894

Code	CSB-MP006043HU1
Abbreviation	Recombinant Human CSF1 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$190
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity The ED₅₀ as determined by the dose-dependent stimulation of the proliferation of THP-1 cells is 2.880-4.115 ng/mL. Biological Activity Assay Activity Measured by its binding ability in a functional ELISA. Immobilized Human CSF1 protein at 2 μg/ml can bind Anti-CSF1 recombinant antibody (CSB-RA006043MA1HU). The EC₅₀ is 4.291-4.988 ng/mL. Biological Activity Assay Activity Measured by its binding ability in a functional ELISA. Immobilized Human CSF1 protein at 2 μg/ml can bind Human CSF1R protein (CSB-MP006044HU). The EC₅₀ is 37.37-43.34 ng/mL. CSF1 Recombinant Monoclonal Antibody (CSB-RA006043MA1HU) captured on Protein A Chip can bind Recombinant Human CSF1 protein with an affinity constant of 0.13 nM as detected by MetaSPR Assay (WeSPRTM 200).
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Macrophage colony-stimulating factor 1 (CSF1), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage