Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-YP014679HU |
| Product Type | Recombinant Protein |
| Size | US$2010 |
| Uniprot No. | P14780 |
| Relevance | May play an essential role in local proteolysis of the Extracellular domain matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-|-Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | 92 kDa gelatinase92 kDa type IV collagenaseGelatinase B ;GELB |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | FQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED |
| Research Area | Developmental Biology |
| Source | Yeast |
| Gene Names | MMP9 |
| Protein Names | Recommended name: Matrix metalloproteinase-9 Short name= MMP-9 EC= 3.4.24.35 Alternative name(s): 92 kDa gelatinase 92 kDa type IV collagenase Gelatinase B Short name= GELB Cleaved into the following 2 chains: 1. 6 |
| Expression Region | 107-707aa |
| Tag Info | N-terminal 6xHis-tagged |
| Mol. Weight | 68.6kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | May play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-|-Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide. |
| Involvement in disease | Intervertebral disc disease (IDD); Metaphyseal anadysplasia 2 (MANDP2) |
| Subcellular Location | Secreted, extracellular space, extracellular matrix |
| Protein Families | Peptidase M10A family |
| Tissue Specificity | Produced by normal alveolar macrophages and granulocytes. |
| Database Links |
HGNC: 7176 OMIM: 120361 KEGG: hsa:4318 STRING: 9606.ENSP00000361405 UniGene: Hs.297413 |
| Pathway |
Estrogen signaling pathway
TNF signaling pathway IL-17 signaling pathway Leukocyte transendothelial migration |
MMP9 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-RA014679A0HU | MMP9 Antibody | Human | ELISA, IHC, FC |
MMP9 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA014679GA01HU | MMP9 Antibody | human | ELISA,WB,IHC |
| CSB-PA436677 | MMP9 Antibody | Human | ELISA,WB,IHC |
| CSB-PA142806 | MMP9 Antibody | Human | ELISA,WB,IHC |
| CSB-PA002676 | MMP9 Antibody | Human | WB,IHC,IF,ELISA |
| CSB-PA005569 | MMP9 Antibody | Human | WB,ELISA |
| CSB-PA699938 | MMP9 Antibody | Human | ELISA,IHC |
| CSB-PA255651 | MMP9 Antibody | Human | ELISA,IHC |
| CSB-PA563134 | MMP9 Antibody | Human | ELISA,IHC |
| CSB-PA151401 | MMP9 Antibody | Human | ELISA,WB,IHC |
| CSB-PA294107 | MMP9 Antibody | Human,Mouse,Rat | ELISA,IHC |
| CSB-PA796774 | MMP9 Antibody | Human,Mouse,Rat | ELISA,IHC |
MMP9 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-EP014679HU CSB-BP014679HU CSB-MP014679HU |
Recombinant Human Matrix metalloproteinase-9(MMP9) ,partial | E.coli Baculovirus Mammalian cell |
MMP9 ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-E08006h | Human matrix metalloproteinase 9/Gelatinase B,MMP-9 ELISA Kit | serum, plasma, tissue homogenates, cell culture supernates, urine | 0.284 ng/mL |
Recombinant Human Glutathione peroxidase 1(GPX1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Methylenetetrahydrofolate reductase(MTHFR)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Bovine Beta-1,4-galactosyltransferase 1(B4GALT1),partial
Express system: Yeast
Species: Bos taurus (Bovine)
Recombinant Human Vitamin D-binding protein(GC),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Signal-regulatory protein beta-1(SIRPB1),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human TP53-regulated inhibitor of apoptosis 1(TRIAP1)
Express system: E.coli
Species: Homo sapiens (Human)
