Code | CSB-YP014679HU |
Size |
US$1298Purchase it in Cusabio online store (only available for customers from the US) |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
This protein is a recombinant Human MMP9 protein with N-terminal 6xHis tag. Its purity is 0.9 determined by SDS-PAGE. The production includes 5 steps. 1, obtain the cDNA from the respective mRNA; 2, Select expression vector to insert the MMP9 sequence and get the recombinant plasmid of MMP9; 3, Clone the recombinant plasmid into Yeast; 4, Express the MMP9 protein in the Yeast cell; 5, Protein purification. And finally, the desired recombinant protein was obtained. In addition, the activity has been tested. MMP-9 is the MMP member with vital roles in cancer development. The human MMP-9 gene is located at chromosome 20q13.12. This gene contains 13 exons and 12 introns. Human MMP-9 protein contains hemopexin-like domain, catalytic domain, signal peptide, the hinge region and propeptide region. The catalytic domain of MMP-9 contains fibronectin type II (FN2) domains, active site and zinc-binding region. This protein contains two zinc ions and five calcium ions. As a member of zinc-dependent endopeptidases, MMP-9 requires zinc ion for its catalytic activity. In humans, some types of cells can synthesize and secrete MMP-9, which include neutrophils, macrophages, fibroblasts and endothelial cells. Overexpression of MMP-9 has often been observed in different malignant tumors. Together with MMP-2, MMP-9 belongs to the gelatinase subgroup of the MMP family. Many studies have explored MMP-9 as a biomarker in different types of cancer. Additionally, various novel MMP-9 biosensors have been developed to detect this protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | MMP9 |
Uniprot No. | P14780 |
Research Area | Developmental Biology |
Alternative Names | 82 kDa matrix metalloproteinase-9; 92 kDa gelatinase; 92 kDa type IV collagenase; CLG 4B; CLG4B; Collagenase Type 4 beta; Collagenase type IV 92 KD; EC 3.4.24.35; Gelatinase 92 KD; Gelatinase B; Gelatinase beta; GelatinaseB; GELB; Macrophage gelatinase; MANDP2; Matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase); Matrix Metalloproteinase 9; MMP 9; MMP-9; MMP9; MMP9_HUMAN; Type V collagenase |
Species | Homo sapiens (Human) |
Source | Yeast |
Expression Region | 107-707aa |
Target Protein Sequence | FQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 68.6kDa |
Protein Length | Partial |
Tag Info |
N-terminal 6xHis-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Matrix metalloproteinase that plays an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-|-Leu bond. Cleaves NINJ1 to generate the Secreted ninjurin-1 form. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.
|
Gene References into Functions |
|
Involvement in disease | Intervertebral disc disease (IDD); Metaphyseal anadysplasia 2 (MANDP2) |
Subcellular Location | Secreted, extracellular space, extracellular matrix. |
Protein Families | Peptidase M10A family |
Tissue Specificity | Detected in neutrophils (at protein level). Produced by normal alveolar macrophages and granulocytes. |
Database Links |
HGNC: 7176 OMIM: 120361 KEGG: hsa:4318 STRING: 9606.ENSP00000361405 UniGene: Hs.297413 |