Recombinant Human Matrix metalloproteinase-9(MMP9) ,partial

Code CSB-YP014679HU
Size US$1298
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names MMP9
Uniprot No. P14780
Research Area Developmental Biology
Alternative Names 82 kDa matrix metalloproteinase-9; 92 kDa gelatinase; 92 kDa type IV collagenase; CLG 4B; CLG4B; Collagenase Type 4 beta; Collagenase type IV 92 KD; EC 3.4.24.35; Gelatinase 92 KD; Gelatinase B; Gelatinase beta; GelatinaseB; GELB; Macrophage gelatinase; MANDP2; Matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase); Matrix Metalloproteinase 9; MMP 9; MMP-9; MMP9; MMP9_HUMAN; Type V collagenase
Species Homo sapiens (Human)
Source Yeast
Expression Region 107-707aa
Target Protein Sequence FQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 68.6kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function May play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-|-Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.
Gene References into Functions
  1. Cyclic peptides 1, 2, 46 also displayed potential interaction with active residues of MMP9; thus, these cyclic peptides can serve as potential drug candidates to block MMP9 activity and future studies are warranted to confirm their efficacy. PMID: 30226602
  2. Our findings indicate that monitoring serum MMP-9 and detection of histological MMP-9 could help identify TNBC patients who will respond to NAC and will display varying risks of disease relapse. MMP-9 may serve as a predictive and prognostic biomarker for tailoring and modifying the NAC strategy for TNBC. PMID: 30241470
  3. significantly increased in the serum of type 2 diabetes mellitus patients with diabetic retinopathy PMID: 29752166
  4. Study evaluated for the first time the plasma levels and the diagnostic usefulness of VEGF, MMP-9, and TIMP-1 in cervical cancer (CC), not only independently but especially in combination with established cervical tumor markers. All tested parameters showed statistical significance when compared their concentrations in patients with CC to healthy women. PMID: 30037277
  5. In monocytes, incubation with psoriasis' sera increased the production of MMP-9 and TIMP-1 in comparison with both baseline and monocytes incubated with non-psoriatic sera PMID: 29979898
  6. High mmp9 expression is associated with Endometrial adenocarcinoma. PMID: 30139240
  7. There was studied the level of matrix metalloproteinase-9 (MMP-9) in plasma of bone marrow aspirates in 87 patients: 39 with acute myeloid leukemia (AML) and 48 myelodysplastic syndrome (MDS). It has been found out an association of the level of MMP-9 in plasma of bone marrow aspirates in patients with AML and MDS with a volume of leukemic mass. PMID: 30444586
  8. This study provides the first evidence for the involvement of polymorphisms within MMP9 and the severity of childhood trauma in antipsychotic treatment response PMID: 29448178
  9. HOXD-AS1 was upregulated in non-small cell lung carcinoma tissues and cell lines and promoted NSCLC cell proliferation, migration invasion via sponging miR-133b and regulating MMP9. PMID: 29958139
  10. rs3918241, rs2250889, rs17576 and rs17577 polymorphisms of MMP-9 are not associated with altered risk of urinary cancer. PMID: 30249503
  11. PARP-1, via manipulating the binding of NF-kB/AP-1 at the MMP-9 promoter, regulates MMP-9 expression, which helps maintain mitochondrial homeostasis. PMID: 28478229
  12. The results suggest that the MMP9 gene may affect genetic predisposition to tick-borne encephalitis in a Russian population. PMID: 29496490
  13. MMP-9 was targeted by hsa-miR-494, which inhibited OS. PMID: 29068478
  14. In placenta, a significant positive correlation between MMP-9 and gestational age was noted in the first trimester. When gestational age was controlled for, partial correlation revealed a significant positive correlation between TNF-alpha and MMP-9 only in the second trimester. PMID: 28820024
  15. Melatonin inhibits epithelialtomesenchymal transition in gastric cancer cells via attenuation of IL1beta/NFkappaB/MMP2/MMP9 signaling. PMID: 30066836
  16. Data indicate that CD147 promotes breast cancer cell proliferation, metastasis, and invasion by modulating matrix metalloproteinase 9 (MMP-9) and vascular endothelial growth factor (VEGF) expression. PMID: 29901696
  17. immune system process is indispensable in the progression of disease in colon, and identifies that IL-8 and MMP-9 play potential critical roles for the progression. PMID: 30074183
  18. The demethylation of the MMP-9 gene promoter region may be involved in the occurrence and development of diabetic nephropathy by regulating the expression of MMP-9 protein in serum. PMID: 29952417
  19. Patients carrying the variant T allele of the MMP9 rs3918242 polymorphism exhibited significantly higher infarct volumes than those with the major CC genotype. PMID: 30257242
  20. Increased matrix metalloproteinase-9/tissue inhibitor of metalloproteinase-1 ratio in smokers with airway hyperresponsiveness is associated with accelerated lung function decline. PMID: 29692608
  21. MMP-9 and TIMP-1 levels are correlated with age, pathological grade, tumor size and lymph node metastasis of breast cancer patients. PMID: 30010105
  22. When ANXA5 expression increased, cell proliferation was inhibited by regulating the expression of bcl-2 and bax while cell metastasis was suppressed by regulating E-cadherin and MMP-9 expression. PMID: 30010106
  23. IL-33 can regulate deposition of ECM and promote the process of pulmonary fibrosis by inducing the imbalance between MMP-9 and TIMP-1. PMID: 29417309
  24. Results show that MMP9 specifically binds to H3K27me1 nucleosomes allowing the cleavage of H3N-terminal tail. PMID: 29807539
  25. Study shows that rs1056629 polymorphism in the 3'UTR of MMP9 disrupts its binding to miR-491 in pressure ulcer (PU)patients after hip fracture. mRNA and protein expression levels are high in PU specimens. PMID: 29620239
  26. No association between the carriage of studied MMP9 polymorphisms and the predisposition to preeclampsia was found. PMID: 29670668
  27. the logistic regression analysis, none of the genes was associated with AOB (anterior open bite). In conclusion, the polymorphism rs17576 (glutamine for arginine substitution) in MMP9 was a protective factor for AOB PMID: 29297546
  28. Results provide evidence that MMP9 plays critical roles in mesenchymal stem cells high suppressive potency, which also involves the capacity to induce and integrated multiple immunoregulatory mechanisms. PMID: 28408751
  29. piperine reduced the expression of pAkt, MMP9 and pmTOR. Together, these data indicated that piperine may serve as a promising novel therapeutic agent to better overcome prostate cancer metastasis. PMID: 29488612
  30. Our study demonstrated that both positive expression status in tumor tissue and expression levels of MMP-9 are significantly elevated in BC patients and correlate with disease progression. Thus, MMP-9 can serve as a biomarker to determine the degree of BC malignancy. PMID: 29578150
  31. Our findings indicate that overexpression of MMP-9 rescued insulin survival signaling in vitro and in early stages in the 5XFAD model of AD. PMID: 28386117
  32. Review/Meta-analysis: Matrix metalloproteinase-9 has high predictive value for hemorrhagic transformation after acute ischemic stroke. PMID: 29598905
  33. The expression of MMP-9 is associated with clinical outcome in chondrosarcoma. PMID: 29316907
  34. MMP-9 levels in the tumor tissue extracts had also increased significantly PMID: 29520667
  35. MMP-9 -1562 C/T polymorphism might be related to the digestive cancer susceptibility [meta-analysis] PMID: 29890308
  36. MMP-9 protein overexpression was found in prostate cancers, low expression in any of the normal tissues or in benign prostatic tissue PMID: 27355218
  37. Hypoxia promotes retinoblastoma cell line HXO-RB44 invasion by activating HIF-1alpha/MMP9 signaling pathway. PMID: 29243776
  38. Authors conclude that ADAM8 promotes early metastatic processes such as transendothelial migration by upregulation of MMP-9 and shedding of PSGL-1 from breast cancer cells. PMID: 28986926
  39. High expression of MMP-9 and TLR4 in patients with COPD may promote inflammatory cell infiltration, induce proliferation of smooth muscle cells, degrade extracellular matrix, and play an important role in lung revascularization. PMID: 28537664
  40. The data obtained from this study show that mild hypothermia therapy down regulated the expression of MMP-9 mRNA, the MMP-9 protein level and increased the FOUR score and GCS in high-risk TBI patients within 72 h. PMID: 28966304
  41. High MMP9 expression is associated with cervical cancer. PMID: 30052166
  42. MMP-9 overexpression and activation are important events occurring during oral squamous cell carcinoma progression/invasion and that this overexpression/activation is regulated by c-Myc, active MMP-2 and inactive GSK3beta mediated pathways. PMID: 29134466
  43. Plasma concentration of MMP9 demonstrated no associations with stroke occurrence in a West African cohort. PMID: 29074065
  44. High mmp9 expression is associated with ovarian cancer cell migration and invasion. PMID: 28677781
  45. no significant difference was detected in the expression level of individual MMP9 and TIMP1 genes in SCZ patients versus healthy controls either in total numbers of subject or in sex based subgroups PMID: 28578515
  46. Data suggest that MIR129 or MIR335 overexpression in keratinocytes inhibits MMP9 promoter activity and protein expression by targeting SP1; inhibition of these microRNAs has the opposite effect. These mechanisms may be involved in regulation of wound healing. (MIR = microRNA; MMP9 = matrix metalloproteinase-9; SP1 = transcription factor-SP1) PMID: 29748291
  47. Significant association observed for MMP-9 (-1562C/T) (OR 1.27; 95% CI 1.06 to 1.53) gene polymorphism and risk of ischemic stroke. [meta-analysis] PMID: 29906531
  48. MMP-9 activity increases postpartum. Women experiencing uncomplicated vaginal delivery demonstrate higher postpartum MMP-9 activity and are more likely to have recovered their vaginal angle. PMID: 29155140
  49. Results show that MMP9 degrades MMRN2 allowing endothelial cells migration and sprouting angiogenesis. PMID: 28435016
  50. The findings suggest that AEG-1 promotes gastric cancer metastasis through upregulation of eIF4E-mediated MMP-9 and Twist. PMID: 28661037
  51. MMP-9 gene promoter was hypomethylated in preterm placenta as compared to term placenta. PMID: 29130646
  52. study provides further evidence to support a core role of the biological activity of MMP-9 in the pathogenesis of pressure ulcer and indicates that the MMP9-1562 C/T (rs 3918242) functional polymorphism is associated with protection against this disease. PMID: 27405842
  53. Prenatal course of metaphyseal anadysplasia associated with homozygous mutation in MMP9 identified by exome sequencing in two siblings has been described. PMID: 28342220
  54. Results document considerable expression of pro-inflammatory CC chemokines and MMP-9 in human monocytes in response to Ureaplasma isolates in vitro. PMID: 29558521
  55. genetic association studies in a population in north India: Data suggest that an SNP in MMP9 genetic promoter region (-1562C>T) is associated with proliferative diabetic retinopathy in type 2 diabetes patients in the population studied. PMID: 28964682
  56. Carriers of MMP9 rs2250889 allele had shorter time to progression (TTP) of malignant pleural mesothelioma. Carriers of at least one polymorphic MMP9 rs20544 allele had longer TTP. PMID: 29138529
  57. the association study suggests that C1562T and R279Q SNPs of MMP-9 gene can be associated with the susceptibility to myocardial infarction in patients with premature coronary artery disease. PMID: 28453874
  58. MMP-9 and TIMP-2 genes are upregulated in cancerous tissues when compared to normal bladder tissues. PMID: 28980922
  59. Studies show that the expression levels of MMP-9 in brain tissue increased after cerebral hemorrhage and related to the prognosis of brain hemorrhage. MMP-9 is related to post-thrombolytic hemorrhagic transformation after cerebral infarction and, aggravates the early brain injury and cerebral vasospasm after subarachnoid hemorrhage. [review] PMID: 28460607
  60. There was a significantly increased expression of MMP-9 in recurrent ACTH-secreting pituitary tumors compared with the nonrecurrent group. This was strongly associated with the recurrence-free interval. PMID: 29432944
  61. Redox dysregulation and alterations in the immuno-inflammatory pathways are major culprits in the pathogenesis of schizophrenia (SZ). MMP-9 and BDNF SNPs are associated with the clinical phenotype of SZ and, thus, may be a useful marker predicting the phenotypic expression and prognosis of SZ patients. PMID: 28100419
  62. The effects of miR-3713 on Transitional cell carcinoma (TCC) cell growth appeared to result from its modification of MMP9 levels, in which miR-3713 was found to bind to the 3'-UTR of MMP9 mRNA to inhibit its protein translation in TCC cells PMID: 27577949
  63. Knockdown of ROCK1 decreased the volume and weight of the xenograft tumors, while overexpression of ROCK1 showed a proliferative tendency with significantly greater tumor volume and weight in vivo. The upregulation of ROCK1 increased the expression of MMP-9, and levels of MMP-9 positively correlated with the ROCK1 levels in PTC tissues. PMID: 28848996
  64. Studied frequency of MMP genetic polymorphisms in nephrolithiasis. Found high serum MMP-9 in patients with the TT genotype of the C1562T MMP-9 polymorphism. PMID: 28205286
  65. Staphylococcal superantigen like 5 (SSL5) inhibits the MMP9 activity through binding to the catalytic domain, and the beta1-3 region is responsible for the inhibition of proteolytic activity of MMP-9. PMID: 29462623
  66. Lung cancer patients showed significantly lower levels of serum VEGF (1.9 fold) and IL-8 (~9 fold) than COPD patients. VEGF level was significantly higher (2.6 fold) in metastatic than non-metastatic cancer patients. An increase in MMP-9 (~1.6 fold) levels was observed in lung cancer patients. PMID: 27811960
  67. this study provided evidence that miR-133b inhibited cell growth, migration, and invasion through directly targeting MMP9 in NSCLC. PMID: 27938481
  68. corticosteroid-resistant patients have higher basal MMP-9 levels and produce more MMP-9 levels in response to IL-1beta. PMID: 28696822
  69. Decreased expression of MMP9 (for both mRNA and protein) associated with poor ulcer healing in Diabetic Foot Ulcers with infection. PMID: 28682675
  70. MMP9 and TWIST1 were identified as more valuable biological targets for the early diagnosis and targeted therapy of lung cancer through Kaplan-Meier analysis of TCGA lung adenocarcinoma datasets. PMID: 29443542
  71. female patients exhibited lower methylation levels of MMP-9 but higher methylation levels of TIMP-1 compared with male patients, and the methylation levels of TIMP-1 gradually decreased with age. PMID: 29298087
  72. The results suggest an interaction between NGF, GDNF and MMP-9 during the transition to malignancy in prostate cancer (PC). Also this interaction may involve in regulating PC cell differentiation, tumor invasion, progression, and the agressiveness of PC. PMID: 28237042
  73. A high IL-8 content in urine sampled on day 1 after renal transplantation was positively correlated with the activity of metalloproteinase-9 in urine. This proves that both of these chemokines cooperate in ischaemia-reperfusion injuries in transplanted kidneys. PMID: 28494217
  74. our findings demonstrate that 5-hmC loss is an epigenetic hallmark of hepatocellular carcinoma , and miR-29a is an important epigenetic modifier, promoting HCC metastasis through TET-SOCS1-MMP9 axis silencing. The results offer a new strategy for epigenetic cancer therapy PMID: 28661477
  75. Rise in plasma MMP-9 is associated with Chronic lung allograft dysfunction. PMID: 27982503
  76. The authors propose a novel mechanism that involves MMP-9-dependent changes in dendritic spine morphology and the pathophysiology of schizophrenia, providing the first mechanistic insights into the way in which the single base change in the MMP-9 gene (rs20544) influences gene function and results in phenotypic changes observed in schizophrenia patients. PMID: 28623238
  77. These results suggest that HO-1 is involved in oxygen-glucose deprivation-evoked upregulation of apical junctional complex proteins, which is partly mediated by MMP9 pathway. PMID: 29425821
  78. Current findings suggest significant association of MMP9 -1562C>T polymorphism with primary glaucoma in the targeted north Indian population and warrant further replication of the findings in other populations PMID: 29432439
  79. The current study showed a significant association between the MMP9 R279Q G/G polymorphism and formation of glial tumor in advanced age. PMID: 27943225
  80. Zymography assay demonstrated that KLF6 inhibited the activities of matrix metalloproteinase 9 (MMP-9) and weakened the expression of mesenchymal markers, such as snail, slug, and vimentin. Our study is the first to provide demonstrate that KLF6 functions as a tumor suppressor gene and prevents the metastasis of oral cancer cells. PMID: 28638268
  81. The study suggests a significant association of the MMP-9 rs17576 A/G polymorphism with increased risk of Behcet disease development in Egyptian patients. PMID: 28388268
  82. The presence of TNF-alpha-308A allele is associated with increased MMP-9 activity in synovial fluid of patients with early rheumatoid arthritis and may be a predictor of rapid radiographic progression of disease. PMID: 28573370
  83. our findings suggested that overexpressed HRE-MMP-9 was associated with glial scar degradation and angiogenesis in the delayed phase of stroke, which seemed to be essential for subsequent neurogenesis and synaptogenesis and finally promoted neurological recovery PMID: 28396199
  84. The extremely low-frequency electromagnetic fields accelerates wound healing modulating expression of the MMP-9 via Akt/ERK pathway. PMID: 29357406
  85. Recombinant human MLCK was concentration- and time-dependently degraded by recombinant human MMP9 in vitro, and this process was prevented by the MMP9 inhibitor. PMID: 29262413
  86. These findings demonstrate that PTK7 upregulates MMP9 through activation of AP-1 and NF-kappaB and, thus increases invasive properties of ESCC cells. PMID: 27689325
  87. The results of this study demonstrate that the gene expression of MMP9, MMP12, TIMP1 and TIMP2 was influenced by the addition of TGF-beta1. These results may be translated to chronic venous insufficiency framework and suggest involvement of TGF-beta1 in the vein wall pathology. PMID: 27329669
  88. results indicate a novel mechanism of alcohol craving that involves MMP-9-dependent synaptic plasticity in Central Amygdala. PMID: 28190519
  89. The data suggest that ARTN and MMP-9 are involved in the occurrence, development, invasion and metastasis of EC, and play a synergistic role in the development of EC and lymphatic metastasis. PMID: 29254290
  90. eIF4E and MMP9 expression in endometrial cancer specimens suggests their potential up-regulation during carcinogenesis. PMID: 29254314
  91. macrophage-secreted MMP-9 released HB-EGF from macrophages, which increased MMP9 in OVCA433, resulting in a positive feedback loop to drive HB-EGF release and increase proliferation in co-culture. PMID: 27888810
  92. Results indicate an association between a matrix metallopeptidase 9 (MMP9) single-nucleotide polymorphisms (SNPs) at the rs2274755 locus and a decreased risk of steroid-induced osteonecrosis of the femoral head (ONFH) in a northern Chinese population. PMID: 27637086
  93. HMOX1 negatively regulates MMP-9 expression in chronic lymphocytic leukemia cells in response to arsenic trioxide, through modulation of the p38 MAPK/AP-1 signaling pathway. PMID: 27829220
  94. Study shows that expression of MMP9 expression was significantly higher in macrophages and regulated by AEG-1 in hypopharyngeal cancer. PMID: 27793010
  95. Study identifies the tumor suppressor role of epithelial derived-MMP9 in colitis associated cancer via novel mechanistic pathway "MMP9-Notch1-ARF-p53 axis" regulating apoptosis, cell-cycle arrest and DNA damage. PMID: 27861153
  96. Caveolin-1 has a role in promoting Ewing sarcoma metastasis regulating MMP-9 expression through MAPK/ERK pathway PMID: 27487136
  97. These results demonstrated that miR-183 plays a critical role in endometrial cancer tumorigenesis and metastasis by suppressing MMP-9 expression, which may be an attractive therapeutic target for the treatment of endometrial cancer. PMID: 28273643
  98. Herein, we propose a new ILK-MMP9-MRTF axis that appears to be critical for endothelial-mesenchymal transition differentiation of endothelial to cancer-associated fibroblasts -like cells. Thus, it might be an attractive target for cancer treatment PMID: 28893556
  99. Results show that MMP-9 SNPs-contribution to end-organ damage could be dependent of features associated with obesity and hypertension. PMID: 29288728
  100. MMP-9 concentrations in both plasma and CSF, measured within 48h after subarachnoid hemorrhage, were highly predictive of the occurrence of delayed cerebral ischemia. PMID: 27355865

Show More

Hide All

Involvement in disease Intervertebral disc disease (IDD); Metaphyseal anadysplasia 2 (MANDP2)
Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families Peptidase M10A family
Tissue Specificity Produced by normal alveolar macrophages and granulocytes.
Database Links

HGNC: 7176

OMIM: 120361

KEGG: hsa:4318

STRING: 9606.ENSP00000361405

UniGene: Hs.297413

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1