Recombinant Human Matrix metalloproteinase-9(MMP9) ,partial

Code CSB-YP014679HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P14780
Relevance May play an essential role in local proteolysis of the Extracellular domain matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-|-Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 92 kDa gelatinase92 kDa type IV collagenaseGelatinase B ;GELB
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence FQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
Research Area Developmental Biology
Source Yeast
Gene Names MMP9
Protein Names Recommended name: Matrix metalloproteinase-9 Short name= MMP-9 EC= 3.4.24.35 Alternative name(s): 92 kDa gelatinase 92 kDa type IV collagenase Gelatinase B Short name= GELB Cleaved into the following 2 chains: 1. 6
Expression Region 107-707aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 68.6kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-|-Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.
Involvement in disease Intervertebral disc disease (IDD); Metaphyseal anadysplasia 2 (MANDP2)
Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families Peptidase M10A family
Tissue Specificity Produced by normal alveolar macrophages and granulocytes.
Database Links

HGNC: 7176

OMIM: 120361

KEGG: hsa:4318

STRING: 9606.ENSP00000361405

UniGene: Hs.297413

Pathway Estrogen signaling pathway
TNF signaling pathway
IL-17 signaling pathway
Leukocyte transendothelial migration

Related Products

MMP9 Antibodies

MMP9 Antibodies for Human

MMP9 Antibodies for Homo sapiens (Human)

MMP9 Proteins

MMP9 Proteins for Homo sapiens (Human)

MMP9 ELISA Kit

MMP9 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.