Recombinant Human Myeloid cell surface antigen CD33 (CD33), partial (Active)

In Stock Promotion
Code CSB-MP004925HU
Abbreviation Recombinant Human CD33 protein, partial (Active)
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,780+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized CD33 at 2 μg/ml can bind Anti-CD33 rabbit monoclonal antibody, the EC50 of human CD33 protein is 4.289- 5.312 ng/ml. Biological Activity Assay

  • The purity of Human CD33 was greater than 90% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized CD33 at 2 μg/ml can bind Anti-CD33 rabbit monoclonal antibody, the EC50 of human CD33 protein is 4.289- 5.312 ng/ml.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
CD33; SIGLEC3; Myeloid cell surface antigen CD33; Sialic acid-binding Ig-like lectin 3; Siglec-3; gp67; CD antigen CD33
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
18-259aa
Target Protein Sequence
DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
Mol. Weight
56.9 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-Myc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The CD33 protein CSB-MP004925HU is a recombinant human CD33 produced in mammalian cells, with a C-terminal Fc-Myc-tag. Its expression region corresponds to amino acids 18-259 of the human CD33 protein. This recombinant CD33 protein is biologically active, low in endotoxin (less than 1.0 EU/µg protein, determined by the LAL method), and high in purity (greater than 95%, SDS-PAGE). In the functional ELISA, this CD33 protein binds to the anti-CD33 antibody with an EC50 constant of 4.289- 5.312 ng/ml. It is available now.

CD33 is a type I transmembrane protein exclusively expressed on immune cells, including myeloid stem cells, myeloblasts and monoblasts, monocytes/macrophages, granulocyte precursors, and mast cells. It is an excellent myeloid marker for acute myelocytic leukemia (AML). CD33 is mainly involved in the regulation of immune cell functions, such as phagocytosis, cytokine release, and apoptosis.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Sialic-acid-binding immunoglobulin-like lectin (Siglec) that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state. Preferentially recognizes and binds alpha-2,3- and more avidly alpha-2,6-linked sialic acid-bearing glycans. Upon engagement of ligands such as C1q or syalylated glycoproteins, two immunoreceptor tyrosine-based inhibitory motifs (ITIMs) located in CD33 cytoplasmic tail are phosphorylated by Src-like kinases such as LCK. These phosphorylations provide docking sites for the recruitment and activation of protein-tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2. In turn, these phosphatases regulate downstream pathways through dephosphorylation of signaling molecules. One of the repressive effect of CD33 on monocyte activation requires phosphoinositide 3-kinase/PI3K.
Gene References into Functions
  1. rs3865444 CD33 acts as a protective factor against late-onset Alzheimer's disease. PMID: 28477215
  2. Genetic variations in CD33 influence atrophy of specific Alzheimer's Disease-related brain structures; specifically the hippocampus and parahippocampal gyrus. PMID: 26803496
  3. The mean percentage of CD33-positivity of the myeloblast population was 80.5% in acute myeloid leukemia (AML), 81.8% in chronic myelomonocytic leukemia (CMML) and 75% in myelodysplastic syndromes (MDS). PMID: 26726757
  4. The 161533 TriKE induced superior NK cell cytotoxicity, degranulation, and cytokine production against CD33(+) HL-60 targets and increased NK survival and proliferation. PMID: 26847056
  5. High efficacy of CD33/CD3 TandAbs in various preclinical models of human AML. PMID: 27189165
  6. The use of CD33(+)CD11b(+)HLA-DR(-) cells as a predictive and prognostic biomarker. PMID: 27178742
  7. Data suggest that two SNPs in CD33 (rs3865444A, rs12459419T) that are protective of Alzheimer disease result in splice variants (CD33M, CD33m); CD33M localizes predominantly at cell surface in macrophage cell line; CD33m is primary intracellular form in neutrophils and a microglia cell line; intracellular CD33m accumulates in peroxisomes; activation of macrophages/neutrophils does not mobilize CD33m to cell surface. PMID: 28747436
  8. In cutaneous diffuse large b-cell lymphoma, a considerable proportion of CD33(+) myeloid-derived suppressor cells (MDSCs) with PD-L1 coexpression was admixed. Tumor cells expressed CD33 to variable degrees (2% to 60%). We propose that PD-L1(+) tumor cells and PD-L1(+) MDSCs shield the tumor against PD-1(+) tumor-infiltrating lymphocytes, consequently leading to inhibition and diminution of tumor-infiltrating lymphocytes. PMID: 28504999
  9. patients with the CC genotype for rs12459419 have a substantial response to Gemtuzumab Ozogamicin, making this a potential biomarker for the selection of patients with a likelihood of significant response to Gemtuzumab Ozogamicin. PMID: 28644774
  10. CD33-expressing microglia play a central role in the development of leukoencephalopathy in Nasu-Hakola disease brains PMID: 26087043
  11. There is substantial evidence that rs3865444 (CD33) function is related to AD pathways and pathology, but our data does not support an interaction with rs670139 (MS4A4E) that impacts AD risk. PMID: 26449541
  12. this study investigated the contribution of the immunoregulatory receptor CD33 to a uniquely human postreproductive disease, Alzheimer's dementia. PMID: 26621708
  13. the CD33 rs3865444 polymorphism is associated with Alzheimer's disease susceptibility in Chinese, European, and North American populations. PMID: 25186233
  14. CD33 and MS4A cluster variants are associated with LOAD susceptibility in East Asian populations. PMID: 26455864
  15. Among those with one or more APOE epsilon4 alleles, having one or more copies of the CD33 C (risk) allele may further increase the risk of cognitive decline PMID: 26102276
  16. decreased TREM2 expression with CD33 suppression and elevated cortical TREM2 mRNA expression with amyloid pathology PMID: 26414614
  17. we propose a model wherein a modest effect on RNA splicing is sufficient to mediate the CD33 association with AD risk and suggest the potential for an anti-CD33 antibody as an AD-relevant pharmacologic agent. PMID: 25762156
  18. Its single-nucleotide polymorphism rs3865444 in the CD33 gene as being associated with the reduced risk of developing Alzheimer's disease. PMID: 25448602
  19. 87.8% of AMLs express CD33. Additionally, 9.4% of AMLs express CD123 without concomitant CD33 expression. PMID: 24927407
  20. This study showed that CD13 and CD33 expression associated with poor prognosis in patients with MM implicating the need of analysis of these markers in MM diagnosis. PMID: 24991573
  21. Lectin galactoside-binding soluble 3 binding protein (LGALS3BP) is a tumor-associated immunomodulatory ligand for CD33-related Siglecs. PMID: 25320078
  22. The rs3865444(C) risk allele is strongly associated with greater expression of CD33 exon 2 and increased Alzheimer's disease susceptibility. [Meta-analysis] PMID: 24381305
  23. Dasatinib enhances migration of monocyte-derived dendritic cells by reducing phosphorylation of inhibitory immune receptors Siglec-9 and Siglec-3. PMID: 24882272
  24. This review discusses the recent epidemiological findings of CD33 that relate to Alzheimer's disease and the pathogenic roles played by CD33 in this disease. PMID: 23982747
  25. Case Report: indolent T-lymphoblastic proliferation with disseminated multinodal involvement with partial CD33 expression on T cells. PMID: 24618611
  26. Data suggest that the CD16xCD33 bispecific killer cell engager (BiKE) functions against both CD33(+) myelodysplastic syndromes (MDS) and myeloid-derived suppressor cells (MDSCs) targets and may be therapeutically beneficial for MDS patients. PMID: 24652987
  27. Results indicate that anti-CD33 chimeric receptors strongly enhance anti-leukemic cytokine-induced killer cell functions. PMID: 20713459
  28. these results suggest a novel model wherein single nucleotide polymorphism-modulated RNA splicing modulates CD33 function and, thereby, Alzheimer disease risk. PMID: 23946390
  29. Our data suggest that genetic variations in CD33 could impact clinical outcome of GO-based therapy in pediatric acute myeloid leukemia . PMID: 23444229
  30. This study showed that the rs3865444(C) risk allele was associated with greater cell surface expression of CD33 in the monocytes (t50 = 10.06, P(joint) = 1.3 x 10(-13)) of young and older individuals. PMID: 23708142
  31. The minor allele of the CD33 SNP rs3865444, which confers protection against Alzheimer disease, was associated with reductions in both CD33 expression and insoluble amyloid beta 42 (Abeta42) levels in AD brain. PMID: 23623698
  32. results support the view that single-nucleotide polymorphisms in GOLPH2 and in near gene 5' region of CD33 are significantly associated with sporadic Alzheimer's disease in the north Chinese Han population. PMID: 22167654
  33. CD33 is expressed abundantly on immature CD34(+)/CD38(-) stem cells and may serve as a stem cell target in chronic myeloid leukemia. PMID: 21993666
  34. data revealed the allele (T) of the rs3865444 polymorphism of the CD33 gene and the allele (C) of the rs610932 polymorphism of the MS4A6A gene may contribute to Alzheimer's disease risk in the Chinese Han population PMID: 22382309
  35. Studies indicate that CD33 is expressed on hepatocytes, which makes them susceptible for targeted CD33 chemotherapy. PMID: 21329979
  36. expression and localization of the two CD33 isoforms on several hematopoietic cell lines PMID: 21278227
  37. found independent evidence for association for Alzheimer's disease susceptibility loci at EPHA1, CD33 and CD2AP PMID: 21460840
  38. Common variants at MS4A4/MS4A6E, CD2AP, CD33 and EPHA1 are associated with late-onset Alzheimer's disease. PMID: 21460841
  39. Specific induction of CD33 expression by E2A-HLF is associated with acute Lymphoblastic Leukemia. PMID: 20147975
  40. Regulation of myeloid cell proliferation and survival by p75/AIRM1 and CD33 surface receptors. PMID: 11774609
  41. Sites of serine/threonine phosphorylation by protein kinase C and the effect on its lectin activity PMID: 11964282
  42. effectiveness of in vivo ablation of CD33+ cells to treat patients with aacaute myeloid leukemia. PMID: 11970770
  43. review of structure, function, expression and clinical application PMID: 12144127
  44. Expression of CD33 on CD4(+)CD56(+) lineage-negative cells should not exclude the diagnosis of plasmacytoid dendritic cell leukemia. PMID: 15388576
  45. Amount of internalization of CD33 following antibody binding for gemtuzumab ozogamicin induced cytotoxicity suggest novel therapeutic approaches for improvement of clinical outcome of leukemia patients. PMID: 15454492
  46. incubation of leukemia cells with anti-CD33 mAb and anticancer agents leads to additive antiproliferative effects and enhanced cytotoxicity. PMID: 15676214
  47. Expression is rarely decreased in association with chromic myelogenous leukemia. PMID: 17662271
  48. The results demonstrate that phosphorylation-dependent ubiquitylation of the immunoreceptor tyrosine-based inhibitory motif (ITIM) of CD33 regulates cell surface expression and internalization of this immunoreceptor. PMID: 18062779
  49. CD13 was expressed in 73% of acute myeloid leukemia patients, CD15 was expressed in 43% of patients, CD33 was expressed in 64% of patients, and CD34 was expressed in 66% of patients. PMID: 18085638
  50. The species-specific differences in the expression expression of Siglecs in SIV infection was studied. PMID: 18331725

Show More

Hide All

Subcellular Location
[Isoform CD33M]: Cell membrane; Single-pass type I membrane protein.; [Isoform CD33m]: Peroxisome.
Protein Families
Immunoglobulin superfamily, SIGLEC (sialic acid binding Ig-like lectin) family
Tissue Specificity
Monocytic/myeloid lineage cells. In the brain, CD33 is mainly expressed on microglial cells.
Database Links

HGNC: 1659

OMIM: 159590

KEGG: hsa:945

STRING: 9606.ENSP00000262262

UniGene: Hs.83731

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*