Recombinant Human Nectin-4 (NECTIN4), partial, Biotinylated

Code CSB-EP822274HU-B
Abbreviation Recombinant Human NECTIN4 protein, partial, Biotinylated
MSDS
Size $268
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
Ig superfamily receptor LNIR;Nectin cell adhesion molecule 4;Poliovirus receptor-related protein 4
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
91-199aa
Target Protein Sequence
SPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPLPSLNPGPALEEGQGLTLAASCTAEGSPAPSVTWDTEVKGTTSSRSFKHS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
59.3 kDa
Protein Length
Partial
Tag Info
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Seems to be involved in cell adhesion through trans-homophilic and -heterophilic interactions, the latter including specifically interactions with NECTIN1. Does not act as receptor for alpha-herpesvirus entry into cells.; (Microbial infection) Acts as a receptor for measles virus.
Gene References into Functions
  1. We suggest that Nectin-4 is a relevant prognostic factor and a therapeutic target in luminalB (HER2 negative) breast cancer. PMID: 28778498
  2. Nectin-4 promotes cell-cell adhesion/aggregation, migration, and proliferation of ovarian tumor cells. PMID: 28038455
  3. Nectin-4 is not only a BCSC marker but also a breast cancer metastasis marker PMID: 28600142
  4. This study suggests that PVRL4 is post-transcriptionally regulated by miR-128 and miR-31. PMID: 27507538
  5. High Nectin-4 expression is associated with neoplasms. PMID: 27013195
  6. We show that Measles virus gains entry into MCF7, DLD-1, and HTB-20 cancer cells through a PVRL4-mediated macropinocytosis pathway and identified the typical cellular GTPase and kinase involved. PMID: 28250131
  7. nectin-4 serves as a stimulatory co-receptor for the prolactin receptor by regulating the feedback inhibition of SOCS1 in the JAK2-STAT5a signaling pathway PMID: 28258213
  8. Nectin-4 is both a new promising prognostic biomarker and specific therapeutic target for Triple-negative breast cancers PMID: 27998973
  9. ADAM17 and ADAM10 cleave Nectin-4 and release soluble Nectin-4 (sN4). PMID: 28232483
  10. The data presented in this study suggested that nectin-4 may be a therapeutic target for systemic lupus erythematous through affecting the cell apoptosis PMID: 26617807
  11. Nectin-4 is critical for gallbladder cancer cell progression via PI3K/AKT pathway activation of Rac1. PMID: 26949052
  12. Nectin-4 expression, when compared with control group, was higher in endometriotic lesions of patients having ovarian endometriosis and peritoneal endometriosis. This difference was significant in the endometrium of patients having endometriosis. PMID: 27328518
  13. Transformation of breast cancer cells is dependent on PVRL4. PMID: 23682311
  14. Nectin-4 is a significant prognostic predictor, and may play a critical role in pancreatic cancer. Nectin-4 may be novel therapeutic target for pancreatic cancer. PMID: 25888293
  15. In airway epithelial cells, measles virus spread requires the nectin-4/afadin complex and is based on cytoplasm transfer between columnar cells. PMID: 25926640
  16. The present study described clinical investigation of the EDSS1 identified in a large consanguineous family; DNA sequence analysis revealed a novel homozygous nonsense mutation (181C>T, p.Asp61*) in the PVRL4 gene. PMID: 25529316
  17. Ovarian tissue expression and serum nectin 4 appear to be potential markers in ovarian cancer. PMID: 25019423
  18. Authors show that the same key residues in the BC and FG loops of nectin-4 govern binding to the measles virus attachment protein hemagglutinin (H) and cell entry, nectin-4 homodimerization, and heterodimerization with nectin-1. PMID: 25275122
  19. data outline a synergistic action of nectin-1 and -4 in the early steps of AJ formation and implicate this interaction in modulating the Rac1 signaling pathway PMID: 24577405
  20. Ablation of nectin4 binding compromises CD46 usage by a hybrid vesicular stomatitis virus/measles virus. PMID: 24335299
  21. Thus, while nectin-4 and CD46 interact functionally with the measles virus H protein beta4-beta5 hydrophobic groove, SLAM merely covers it. PMID: 23760251
  22. Data suggest that expression of nectin-4 is up-regulated in eutopic endometrium of patients with endometriosis compared with control subjects. PMID: 22926846
  23. We show that human nectin4 is fully functional as a canince distemper virus receptor. PMID: 23174504
  24. structure of the membrane-distal domain of nectin-4 in complex with measles virus hemagglutinin (MV-H; structure shows nectin-4 binds the MV-H beta4-beta5 groove exclusively via its N-terminal IgV domain; the contact interface is dominated by hydrophobic interactions PMID: 23202587
  25. crystals of nectin-4 diffracted to 1.8 A resolution and belonged to space group P2(1), with unit-cell parameters a = 33.1, b = 51.7, c = 56.9 A, beta = 94.7 degrees PMID: 22869128
  26. measles virus targets nectin-4 to emerge in the airways PMID: 22048310
  27. Measles virus infection reduced PVRL4 surface expression in MCF7 cells, a property that is characteristic of receptor-associated viral infections. PMID: 21901103
  28. The findings of study suggest that increased expression of Nectin-4 may indicate a worse prognosis in breast cancer patients. PMID: 21526486
  29. Sequence analysis revealed a homozygous missense mutation (c.635C>G; p.Pro212Arg) in the recently reported PVRL4 gene causing EDSS1 PMID: 21346770
  30. Ectoderma dysplasia-syndactyly syndrome. Second example of "nectinopathy". PMID: 21333831
  31. nectin 4 may serve as a potential biomarker that helps discriminate benign gynecologic diseases from ovarian cancer in a panel with CA125. PMID: 20959669
  32. Ectodermal dysplasia-syndactyly syndrome is the second known "nectinopathy" caused by mutations in a nectin adhesion molecule. PMID: 20691405
  33. the active form of TACE is overexpressed in breast tumors and may indicate that TACE is responsible for Nectin-4 shedding not only in vitro but also in vivo PMID: 15784625
  34. Nectin-4 was not detected in normal breast epithelium; by contrast Nectin-4 was expressed in ductal breast carcinoma. PMID: 17474988
  35. Nectin-4 might play a significant role in lung carcinogenesis, and it should be a new candidate serum and tissue biomarker, as well as a therapeutic target. PMID: 19679554

Show More

Hide All

Involvement in disease
Ectodermal dysplasia-syndactyly syndrome 1 (EDSS1)
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell junction, adherens junction. Note=Colocalizes with AFDN at cadherin-based adherens junctions (PubMed:11544254).; [Processed poliovirus receptor-related protein 4]: Secreted. Note=The secreted form is found in breast tumor patients (PubMed:15784625).
Protein Families
Nectin family
Tissue Specificity
Predominantly expressed in placenta. Not detected in normal breast epithelium but expressed in breast carcinoma.
Database Links

HGNC: 19688

OMIM: 609607

KEGG: hsa:81607

STRING: 9606.ENSP00000356991

UniGene: Hs.492490

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*